Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45150-AT3G60620
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cytidinediphosphate diacylglycerol synthase 4
Function (paralog2):cytidinediphosphate diacylglycerol synthase 5

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.3172711928459
Log2 mRNA fold difference:1.9925860602066
Log2 TE fold difference:-0.64870773356891
Sequences
Protein sequence

MTNTNTLFLRHDDDSEILIFQENSVFPLFVFASWGIWRAMATFAELVLSTSRCTCPCRSF
TRKPLIRPPLSGLRLPGDTKPLFRSGLGRISVSRRFLTAVARAESDQLGDDDHSKGIDRI
HNLQNVEDKQKKASQLKKRVIFGIGIGLPVGCVVLAGGWVFTVALASSVFIGSREYFELV
RSRGIAKGMTPPPRYVSRVCSVICALMPILTLYFGNIDILVTSAAFVVAIALLVQRGSPR
FAQLSSTMFGLFYCGYLPSFWVKLRCGLAAPALNTGIGRTWPILLGGQAHWTVGLVATLI
SFSGVIATDTFAFLGGKTFGRTPLTSISPKKTWEGTIVGLVGCIAITILLSKYLSWPQSL
FSSVAFGFLNFFGSVFGDLTESMIKRDAGVKDSGSLIPGHGGILDRVDSYIFTGALAYSF
IKTSLKLYGV

MAPFVEVCRYKPLPLSLSSLCTCPCRSSPRKYLILPQFSEKYPKPLLSHSRFTPISVNRR
VITAVARAESNQIGDDANSKEEHNIDQELQNVEEDSSLDDQKQKSRSQFKKRVTFGLGIG
LSVGGIVLAGGWVFTVAVAAAVLLSAREYFELVRSKGIAQGMTPPPRYLSRVCSIICALM
PILTLYFGHIDISITSAAFVVAMALLLQRGNPRFSQLSSTMFGLFYCGYLPCFWVKLRCG
LTAPVLNTGIGRSWPTILGGQAHWTVGLVAILISFCGIIASDTFAFLGGKAFGRTPLISI
SPKKTWEGAFAGLVGCISITILLSKSLSWPQSLVSTIAFGVLNFFGSVFGDLTESMIKRD
AGVKDSGSLIPGHGGILDRVDSYIFTGALAYSFVRLHGV

Other information
Ka divergence:0.332351KaKs divergence:-0.143746
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1293Length 2 (bp):1200Length divergence:-0.037
MFE 1 (kcal):-373.07MFE 2 (kcal):-345.86MFE divergence-0.038