Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45160-AT3G60630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):GRAS family transcription factor
Function (paralog2):GRAS family transcription factor

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.047344266390608
Log2 mRNA fold difference:0.010352997165741
Log2 TE fold difference:0.037145101294331
Sequences
Protein sequence

MPLSFERFQGEGVFGLSSSSFYSDSQKIWSNQDKTEAKQEDLGYVVGGFLPEPTSVLDAL
RSPSPLASYSSTTTTLSSSHGGGGTTVTNTTVTAGDDNNNNKCSQMGLDDLDGVLSASSP
GQEQSILRLIMDPGSAFGVFDPGFGFGSGSGPVSAPVSDNSNLLCNFPFQEITNPAEALI
NPSNHCLFYNPPLSPPAKRFNSGSLHQPVFPLSDPDPGHDPVRRQHQFQFPFYHNNQQQQ
FPSSSSSTAVAMVPVPSPGMAGDDQSVIIEQLFNAAELIGTTGNNNGDHTVLAQGILARL
NHHLNTSSNHKSPFQRAASHIAEALLSLIHNESSPPLITPENLILRIAAYRSFSETSPFL
QFVNFTANQSILESCNESGFDRIHIIDFDVGYGGQWSSLMQELASGVGGRRRNRASSLKL
TVFAPPPSTVSDEFELRFTEENLKTFAGEVKIPFEIELLSVELLLNPAYWPLSLRSSEKE
AIAVNLPVNSVASGYLPLILRFLKQLSPNIVVCSDRGCDRNDAPFPNAVIHSLQYHTSLL
ESLDANQNQDDSSIERFWVQPSIEKLLMKRHRWIERSPPWRILFTQCGFSPASLSQMAEA
QAECLLQRNPVRGFHVEKRQSSLVMCWQRKELVTVSAWKC

MPLPFEQFQGKGVLGFLDSSSSPGYKIWANPEKLHGRVEEDLCFVVNNGGFSEPTSVLDS
VRSPSPFVSSSTTTLSSSHGGPSGGGAAAATFSGADGKCDQMGFEDLDGVLSGGSPGQEQ
SIFRLIMAGDVVDPGSEFVGFDIGSGSDPVIDNPNPLFGYGFPFQNAPEEEKFQISINPN
PGFFSDPPSSPPAKRLNSGQPGSQHLQWVFPFSDPGHESHDPFLTPPKIAGEDQNDQDQS
AVIIDQLFSAAAELTTNGGDNNPVLAQGILARLNHNLNNNNDDTNNNPKPPFHRAASYIT
EALHSLLQDSSLSPPSLSPPQNLIFRIAAYRAFSETSPFLQFVNFTANQTILESFEGFDR
IHIVDFDIGYGGQWASLIQELAGKRNRSSSAPSLKITAFASPSTVSDEFELRFTEENLRS
FAGETGVSFEIELLNMEILLNPTYWPLSLFRSSEKEAIAVNLPISSMVSGYLPLILRFLK
QISPNVVVCSDRSCDRNNDAPFPNGVINALQYYTSLLESLDSGNLNNAEAATSIERFCVQ
PSIQKLLTNRYRWMERSPPWRSLFGQCGFTPVTLSQTAETQAEYLLQRNPMRGFHLEKRQ
SSSPSLVLCWQRKELVTVSAWKC

www.000webhost.com

Other information
Ka divergence:0.0198274KaKs divergence:-0.0820853
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):1923Length 2 (bp):1872Length divergence:-0.013
MFE 1 (kcal):-616.98MFE 2 (kcal):-621.26MFE divergence0.003