Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45210-AT3G60690
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SAUR-like auxin-responsive protein family
Function (paralog2):SAUR-like auxin-responsive protein family

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.4406775419444
Log2 mRNA fold difference:0.64974231064278
Log2 TE fold difference:2.1122833028879
Sequences
Protein sequence

MRKIIGFRIGRRVSRWIFRKTRIQRSGYNRIHSTQQACMLMRPLAKLKSWGQRLKQSFRR
RSTRRSAYIPVDHKKADPVPRGHLAIYVGQKDGDCHRVLVPIVYFNHPLFGELLREAEKE
YGFCHEGGITIPCLYSDFERVKTRIASGSSSRVFPWGRHCRN

MRKLRGIKIRRPIKQISRWILRRIKIRRSRYTRLSPNRPVCKPRAITKLISWGRSLTSHS
ARFIGSKCSNSGYIPIGQEPIREKPDPVPKGHSAVYIGKKDGDFQRVLVPIVYFNHPLFG
ELLREAEEEFGFSQEGGITIPCPYSDFKRVQTRIESGSGFCKFPWSRRWQ

www.000webhost.com

Other information
Ka divergence:0.0937939KaKs divergence:-0.0272883
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):489Length 2 (bp):513Length divergence:0.024
MFE 1 (kcal):-151.54MFE 2 (kcal):-146.24MFE divergence-0.018