Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45440-AT3G60880
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):dihydrodipicolinate synthase
Function (paralog2):dihydrodipicolinate synthase 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.60921700994468
Log2 mRNA fold difference:-0.88192395419634
Log2 TE fold difference:0.24977634706413
Sequences
Protein sequence

MAALKGYGLCSMDSALQFPCPKLFNSYKRRSSKWVSPKAAVVPNFHLPMRSLEVKNRTNT
DDIKALRVITAIKTPYLPDGRFDLEAYDDLVNIQIQNGAEGVIVGGTTGEGQLMSWDEHI
MLIGHTVNCFGGSIKVIGNTGSNSTREAIHATEQGFAVGMHAALHINPYYGKTSIEGLIA
HFQSVLHMGPTIIYNVPGRTGQDIPPRAIFKLSQNPNLAGVKECVGNKRVEEYTENGVVV
WSGNDDECHDSRWDYGATGVISVTSNLVPGLMRKLMFEGRNSSLNSKLLPLMAWLFHEPN
PIGINTALAQLGVSRPVFRLPYVPLPLSKRLEFVKLVKEIGREHFVGEKDVQALDDDDFI
LIGRY

MSALKNYGLISIDSALHFPRSNQLQSYKRRNAKWVSPIAAVVPNFHLPMRSLEDKNRTNT
DDIRSLRVITAIKTPYLPDGRFDLQAYDDLVNTQIENGAEGVIVGGTTGEGQLMSWDEHI
MLIGHTVNCFGGRIKVIGNTGSNSTREAIHATEQGFAMGMHGALHINPYYGKTSIEGMNA
HFQTVLHMGPTIIYNVPGRTCQDIPPQVIFKLSQNPNMAGVKECVGNNRVEEYTEKGIVV
WSGNDDQCHDSRWDHGATGVISVTSNLVPGLMRKLMFEGRNSALNAKLLPLMDWLFQEPN
PIGVNTALAQLGVARPVFRLPYVPLPLSKRIEFVKLVKEIGREHFVGDRDVQVLDDDDFI
LIGRY

www.000webhost.com

Other information
Ka divergence:0.221722KaKs divergence:-0.0988836
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1098Length 2 (bp):1098Length divergence:0
MFE 1 (kcal):-319.91MFE 2 (kcal):-323.67MFE divergence0.006