Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45470-AT3G60900
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):FASCICLIN-like arabinogalactan protein 8
Function (paralog2):FASCICLIN-like arabinogalactan-protein 10

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-4.384855099422
Log2 mRNA fold difference:-3.282399601703
Log2 TE fold difference:-0.45421391612367
Sequences
Protein sequence

MAASQTFSLLAFTFSLLAFASTVSSHNITQILADSPDYSSFNSYLSQTKLADEINSRTTI
TVLVLNNGAMSALAGKHPLSVIKSALSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNA
PGNLGFVNITDLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGVLTA
PAPSASLSNITGLLEKAGCKTFANLLVSSGVLKTYESAVEKGLTVFAPSDEAFKAEGVPD
LTKLTQAEVVSLLEYHALAEYKPKGSLKTNKNNISTLATNGAGKFDLTTSTSGDEVILHT
GVAPSRLADTVLDATPVVIFTVDNVLLPAELFGKSKSPSPAPAPEPVTAPTPSPADAPSP
TAASPPAPPTDESPESAPSDSPTGSANSKSANAAVGVSTPSLFTALVTIAAIAVSVSLCS

MATSRAFTLFAFTLSLLTVASTVSGHNITQILSDTPEYSSFNNYLSQTKLADEINSRTTI
TVLVLNNGAMSSLAGKHPLSVVKNALSLLVLLDYYDPLKLHQLSKGTTLTTTLYQTTGHA
LGNLGFVNVTDLKGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEINAPIIAPGILTA
PAPSSAGVSNITGLLEKAGCKTFANLLVSSGVIKTFESTVEKGLTVFAPSDEAFKARGVP
DLTNLTQAEVVSLLEYHALAEYKPKGSLKTNKDAISTLATNGAGKYDLTTSTSGDEVILH
TGVGPSRLADTVVDETPVVIFTVDNVLLPAELFGKSSSPAPAPEPVSAPTPTPAKSPSPV
EAPSPTAASPPAPPVDESSPEGAPSDSPTSSENSNAKNAAFHVNAPALFTALVTIAATSL
LL

Other information
Ka divergence:-0.058387KaKs divergence:-0.332775
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):1263Length 2 (bp):1269Length divergence:0.002
MFE 1 (kcal):-340.54MFE 2 (kcal):-338.87MFE divergence-0.002