Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45740-AT3G61070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):peroxin 11D
Function (paralog2):peroxin 11E

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.6467661317134
Log2 mRNA fold difference:-1.7472192176793
Log2 TE fold difference:0.12508667378584
Sequences
Protein sequence

MGTTLDVSRAELALVVMYLNKAEARDKLCRAIQYGSKFLSGGQPGTAQNVDKSTSLARKV
FRLFKFVNDLHGLISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERA
ELLGRISLFCWMGSSVCTTLVEVGEMGRLSSSMKKIEKGLKNGNKYQDEDYRAKLKKSNE
RSLALIKSAMDIVVAAGLLQLAPTKITPRVTGAFGFITSIISCYQLLPTRPKIKTP

MTTLDLTRAELALIVLYLNKAEARDKICRAIQYGSKFLSGGQPGTAQTVDKNTSLARKVF
RLFKFVNDFHGLISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERTE
LLGRISLFCWLGSSVCTSAVEIGELGRLSSSMKKMEKELKADDELYRAKLQKSNDRTLAL
IKSSMDIIVAIGLLQLAPKTISPRVTGAFGFTTSLISCYQLLPSRPKLKTP

Other information
Ka divergence:0.273331KaKs divergence:-0.407509
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):711Length 2 (bp):696Length divergence:-0.011
MFE 1 (kcal):-205.2MFE 2 (kcal):-190MFE divergence-0.038