Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45760-AT3G61190
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):BON association protein 2
Function (paralog2):BON association protein 1

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:3.6695455915117
Log2 mRNA fold difference:3.703304017231
Log2 TE fold difference:-0.28848569151337
Sequences
Protein sequence

MSYSTFKRSLEIEVISAEGLKVDRKPLKKKTYSVVRIDEKSWASKVDELGGSYPIWKDRF
DMEMPINASVRFISIEVYYRTSGSGRDKNVGYAKIPVTDFMGGFAPQGHLNFLSYRLRDE
YGDKCGIVNVSIMVKPDGNDHKSSLPSSSFAVAPVDYAACSWQATAAARNNQMWRPRTSS
SMVSTAGYGGGRVVTGVPVWCAYQRPS

MIYFGRSIDNHYTTMMTKTLEIDLRSAEGLKLNRRPIKKKTFAVVKIDEKCRKSNLDESR
RSNPTWNYKSEMPINGNEQFIFIEVFYRTGSGHDKKIGEAKIPTNDFMGRYSPEGHLNFL
SYRLRDEFGDKCGIVNLSILVKSDPTRDYGACSSQAAVTGLWRPRLETASIDGYGGRTVT
GVPVWGLYQRQF

www.000webhost.com

Other information
Ka divergence:0.102526KaKs divergence:0.470032
GC content 1 (%):45GC content 2 (%):41GC content divergence:-0.047
Length 1 (bp):624Length 2 (bp):579Length divergence:-0.037
MFE 1 (kcal):-203.3MFE 2 (kcal):-172.5MFE divergence-0.082