Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45810-AT3G61240
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DEA(D/H)-box RNA helicase family protein
Function (paralog2):DEA(D/H)-box RNA helicase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.061802675017083
Log2 mRNA fold difference:-0.37028170267837
Log2 TE fold difference:0.30294023034441
Sequences
Protein sequence

MNNNNNNRGRFPPGIGAAGPGPDPNFQSRNPNPPQPQQYLQSRTPFPQQPQPQPPQYLQS
QSDAQQYVQRGYPQQIQQQQQLQQQQQQQQQQQEQQWSRRAQLPGDPSYIDEVEKTVQSE
AISDSNNEDWKATLKLPPRDNRYQTEDVTATKGNEFEDYFLKRDLLRGIYEKGFEKPSPI
QEESIPIALTGSDILARAKNGTGKTGAFCIPTLEKIDPENNVIQAVILVPTRELALQTSQ
VCKELSKYLKIEVMVTTGGTSLRDDIMRLYQPVHLLVGTPGRILDLAKKGVCVLKDCAML
VMDEADKLLSVEFQPSIEELIQFLPESRQILMFSATFPVTVKSFKDRYLKKPYIINLMDQ
LTLMGVTQYYAFVEERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFY
IHAKMVQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPRTSESYLHRVG
RSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYCQ

MNTNRGRYPPGVGTGRGAPPNPDYHQSYRQQQPPQDQQYVQRGYSQNPQQMQLQQQHQQQ
QQQQQWSRRPQLPGNASNANEVVQQTTQPEASSDANGQDWKATLRLPPPDTRYQTADVTA
TKGNEFEDYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTGAFCI
PVLEKIDPNNNVIQAMILVPTRELALQTSQVCKELSKYLNIQVMVTTGGTSLRDDIMRLH
QPVHLLVGTPGRILDLTKKGVCVLKDCAMLVMDEADKLLSAEFQPSLEELIQFLPQNRQF
LMFSATFPVTVKAFKDRHLRKPYVINLMDQLTLMGVTQYYAFVEERQKVHCLNTLFSKLQ
INQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMVQDHRNRVFHEFRNGACRNLVCTDL
FTRGIDIQAVNVVINFDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQEL
GTEIKPIPSNIDQAIYCQ

www.000webhost.com

Other information
Ka divergence:0.335271KaKs divergence:0.355278
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1587Length 2 (bp):1497Length divergence:-0.029
MFE 1 (kcal):-437.25MFE 2 (kcal):-415.6MFE divergence-0.025