Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45820-AT3G61260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Remorin family protein
Function (paralog2):Remorin family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.1355801311998
Log2 mRNA fold difference:0.49965254824277
Log2 TE fold difference:0.64216122887269
Sequences
Protein sequence

MAEEQKTSKVDVESPAVLAPAKEPTPAPVEVADEKIHNPPPVESKALAVVEKPIEEHTPK
KASSGSADRDVILADLEKEKKTSFIKAWEESEKSKAENRAQKKISDVHAWENSKKAAVEA
QLRKIEEKLEKKKAQYGEKMKNKVAAIHKLAEEKRAMVEAKKGEELLKAEEMGAKYRATG
VVPKATCGCF

MAEEQKIALESESPAKVTTPAPADTPAPAPAEIPAPAPAPTPADVTKDVAEEKIQNPPPE
QIFDDSKALTVVEKPVEEPAPAKPASASLDRDVKLADLSKEKRLSFVRAWEESEKSKAEN
KAEKKIADVHAWENSKKAAVEAQLKKIEEQLEKKKAEYAERMKNKVAAIHKEAEERRAMI
EAKRGEDVLKAEETAAKYRATGIVPKATCGCF

Other information
Ka divergence:0.0704058KaKs divergence:0.267029
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):573Length 2 (bp):639Length divergence:0.054
MFE 1 (kcal):-150.56MFE 2 (kcal):-174.98MFE divergence0.075