Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45830-AT3G61270
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):downstream target of AGL15 2
Function (paralog2):Arabidopsis thaliana protein of unknown function (DUF821)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.022675622156725
Log2 mRNA fold difference:-0.10984819109845
Log2 TE fold difference:0.093963324827746
Sequences
Protein sequence

MLQRKSMKRNNNNLLTNKNKYVYLKTASHPAKSIAKATLFLVTSLFISAGLLDLLGCFDF
TTFTGLKQVTTSIRKSPITSQRFPNQCGVVQNQTQLFPQNGSSRNNDKPRSSHSRISTCP
SYFRWIHEDLRPWKETGVTRGMLEKARRTAHFRVVILDGRVYVKKYRKSIQTRDVFTLWG
IVQLLRWYPGRLPDLELMFDPDDRPTVRSKDFQGQQHPAPPPLFRYCSDDASLDIVFPDW
SFWGWAEVNIKPWDKSLVAIEEGNKMTQWKDRVAYAYWRGNPNVAPTRRDLLRCNVSAQE
DWNTRLYIQDWDRESREGFKNSNLENQCTHRYKIYIEGWAWSVSEKYIMACDSMTLYVRP
MFYDFYVRGMMPLQHYWPIRDTSKCTSLKFAVHWGNTHLDQASKIGEEGSRFIREEVKME
YVYDYMFHLMNEYAKLLKFKPEIPWGATEITPDIMGCSATGRWRDFMEESMVMFPSEESP
CEMPSPFNPHDLKEILERKTNLTRQVEWWEDQYFHDLANIKKP

MKMNNNDGQHNKTVTFPRKSIVKATVFIVVLFISAAILDLLGYLDFNAFAGLKLTTKTKE
PNPYGCDFVQNQSSQTPISQNRKSRLNPNNSSKSSTCPSYFRWIHEDLRPWKQTGITRGM
IEEASRTAHFRLVIRNGKAYVKRYKKSIQTRDEFTLWGILQLLRWYPGKLPDLELMFDAD
DRPVVRSVDFIGQQKEPPPVFRYCSDDASLDIVFPDWSFWGWAEVNVKPWGKSLEAIKEG
NSMTQWKDRVAYAYWRGNPYVDPGRGDLLKCNATEHEEWNTRLYIQDWDKETKEGFKNSN
LENQCTHRYKIYIEGWAWSVSEKYIMACDSMTLYVKPRFYDFYIRGMMPLQHYWPIRDDS
KCTSLKFAVHWGNTHEDKAREIGEVGSRFIREEVNMQYVYDYMFHLLKEYATLLKFKPEI
PLDAEEITPDSMGCPATERWRDFKAESMIISPSEESPCEMLPPYDPLALKEVLERKANLT
RQVELWENQYFQNLTNKP

www.000webhost.com

Other information
Ka divergence:0.0670113KaKs divergence:-0.189495
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1572Length 2 (bp):1497Length divergence:-0.024
MFE 1 (kcal):-464.11MFE 2 (kcal):-418.07MFE divergence-0.052