Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45850-AT3G61310
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):AT hook motif DNA-binding family protein
Function (paralog2):AT hook motif DNA-binding family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.2074780861178
Log2 mRNA fold difference:1.546025620544
Log2 TE fold difference:0.67899167285333
Sequences
Protein sequence

MDRRDAMGLSGSGSYYIHRGLSGSGPPTFHGSPQQQQGLRHLPNQNSPFGSGSTGFGSPS
LHGDPSLATAAGGAGALPHHIGVNMIAPPPPPSETPMKRKRGRPRKYGQDGSVSLALSSS
SVSTITPNNSNKRGRGRPPGSGKKQRMASVGELMPSSSGMSFTPHVIAVSIGEDIASKVI
AFSQQGPRAICVLSASGAVSTATLIQPSASPGAIKYEGRFEILALSTSYIVATDGSFRNR
TGNLSVSLASPDGRVIGGAIGGPLIAASPVQVIVGSFIWAAPKIKSKKREEEASEVVQET
DDHHVLDNNNNTISPVPQQQPNQNLIWSTGSRQMDMRHAHADIDLMRG

MDRRDAMALSGSGSYYIQRGIPGSGPPPPQTQPTFHGSQGFHHFTNSISPFGSNPNPNPN
PGGVSTGFVSPPLPVDSSPADSSAAAAGALVAPPSGDTSVKRKRGRPRKYGQDGGSVSLA
LSPSISNVSPNSNKRGRGRPPGSGKKQRLSSIGEMMPSSTGMSFTPHVIVVSIGEDIASK
VISFSHQGPRAICVLSASGAVSTATLLQPAPSHGTIIYEGLFELISLSTSYLNTTDNDYP
NRTGSLAVSLASPDGRVIGGGIGGPLIAASQVQVIVGSFIWAIPKGKIKKREETSEDVQD
TDALENNNDNTAATSPPVPQQSQNIVQTPVGIWSTGSRSMDMHHPHMDIDLMRG

Other information
Ka divergence:0.236294KaKs divergence:0.513672
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1047Length 2 (bp):1065Length divergence:0.009
MFE 1 (kcal):-325.76MFE 2 (kcal):-315.5MFE divergence-0.016