Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45870-AT3G61320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Bestrophin-like protein
Function (paralog2):Bestrophin-like protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.4596383605342
Log2 mRNA fold difference:2.6384102422773
Log2 TE fold difference:-0.83546287997319
Sequences
Protein sequence

MYQSMNLSFSSNFTNLSFLKPRLYSGISARAPKSLHFKFNPSCVSSGPKSDDSPLSEKLI
SLLKAVPNWSDGIKERRMQQKRSLYTHENWVRHRSSLRHLRHVSSSPSSRVILSLIPPVF
FFTTVAILIAGYNSAVDLDWLPDFFPVLRASPLPYQLTAPALALLLVFRTEASYSRFEQG
RKAWVKIISGTNDLARLVISSVHGSGDELIIRDALLRYIVAFPVALKCHVIYGSDIASDL
KNVIEVDDLSLILQSKHRPRCVIQFISQSLQLLNLDSTKIDMLETKMMQLQEGIGVCEQL
MGIPIPLSYTRLTSRFLVLWHLTLPVILWDDCHWNVVPATFISAASLFCIEEVGVLIEEP
FSMLALDELCAMVLSNSDEAVESKEVIRNRIIAKKRILEIKHSSNGWHKS

MYQSMNLSVSSNFTHRSLLESRFPIFSTGFRKSVNLKPPRVSSGPESNDSGHETLTDKLI
HLLRAVPDWADEIKERGMQQKRSLYTHEKWVEHRSSLRHVRHLLSSFSSRVILSLIPPVF
FFTSVAVVIASYNSAVALDWLPGIFPILRSSSLPYQLTAPALALLLVFRTEASYSRYEEG
RKAWVGIIAGTNDLARQVICSVDSSGDELIIKDLLLRYIAAFPVALKCHVIYGSDIARDL
RNLIEADDLSLILQAKHRPRCVIEFISQSIQLLKLDDAKRDLLESKMLHLHEGIGVCEQL
MGIPIPLSYTRLTSRFLVFWHLTLPIILWDECHWIVVPATFISAASLFCIEEVGVLIEEP
FPMLALDELCDLVHSNIQEAVKSEKVIRNRIIAKIKLHEFKHSSNGRHRS

www.000webhost.com

Other information
Ka divergence:-0.308425KaKs divergence:-0.399384
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1233Length 2 (bp):1233Length divergence:0
MFE 1 (kcal):-343.2MFE 2 (kcal):-350.82MFE divergence0.011