Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45900-AT3G61380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phosphatidylinositol N-acetyglucosaminlytransferase subunit P-related
Function (paralog2):Phosphatidylinositol N-acetyglucosaminlytransferase subunit P-related

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.1316591152711
Log2 mRNA fold difference:1.8311884190695
Log2 TE fold difference:-0.45175657282853
Sequences
Protein sequence

MEKEICRRHLSREGLGCVWVFMSMFDFRHGGSNQKLLMDKKRRSKRIIIGNNGVFETKVE
KQLTCDCDCDEESEAEMQSVKKLIEAEIDEKTTQKCEARNRKRRSRTCSKISEDINVLIA
GDDDDDHAEKSDNECPIVSHNEVDMVNDDSEEKFSELIKRLIAQKESEVESCKKNLVDAF
QVLDSKEESLNIGTPTSGDSQRIKETQTIVILKPEPNTLDVGSSPGTPSTDNKAKNEKFS
SRFSLSRIRRRLKFAVGKNPCNAQHDSDPDPDADALSSSMSQNCCLGEEIETNPGSDGEI
LPDIASKGEANKEDTFHESEKDSKKSMCGIYIAAKKHLSEMLAEGDIDADLPDKEVPRIL
GKILALPEFFTPENSPRVTLALDHQIIEKPNIQQCSSKDYYYEPLRLDSNNHEETEFMPV
PEDTRMEEEEQTVMDSLSEAISSSIIQQDAYIDEDEHKQLLEKEVLKEGQSPCSPPNSSV
RMSECQENTTDVLGKSSPVSVLEPFFTDDDTSPNSSRFSSAEMRMQPLCIRFDEPDFPGP
EKDNDVKTRMDDKELALEYIQAVVKSSELNWEELLARSFYSEKILEQALMDDIDFCSTNL
CSDKKLLFDCINEVLMEFCGHGPWISFVKPAMHFFPDMENAVEVVQEEVYWHLLPLPSPH
TLDQIVRKDLARTGNWMDLRFDIGCIVSETGEIILDELLEEIISNCRDLVQPERINKLVP

MERNCRRNLEREGINGIGCVWVFISLFGSNQKRLLMDNKRGSKRVSGNEMKQITCSCESS
HESVDEEDIHVSVAGDEHVETEVCKSLVDESEEKFKEIIKRLIAQKEGEIQTCKDLLEAF
HVLGSEEEESFLKKKLSNEDAQTLGDSKRVEEEKPEVVSKQEAVVIPKRKANFFSRKWKS
EERRNRSQVAKTIVVLKPGPNTLDVDSSTGLHSTANKSKTGRTFSRFLIGLVKRRLQSAV
GKKSCDVSVDKRSQNCSTQEEIQSKSEEKHDVSDKEEPFCDERTTEDGKEETIYSSEDSK
KIMSGLYIAAKKHLSEMLANGDIDVNLPDKEVPRILGKILSLPEFCSPADSPRLIPAHDL
VSTLSQTTEQPEILQTPETSSATNDLIDEDSDKDDDTLFTIDVSVPRDYGNETENIDNDE
ESEIDPLSETCSSSVSREVENVDEDVEKEMLNHQAHSPASPLESPTTCSVRLTECKETAT
DAQGKLSPVSVLETLFTDDDSSPTTSTSFSSAGMRMQPLCIRFDEVDSPKPEKDNNVEAT
IDDKELTLAYIEAVVKSAALSWEELLTRPFYSEQLLELELTDGIVFSSTQLCDDKNLLYD
CINEVLMDFCWNEFNPGPWISFVKPEVQLISDMEIAAKVAQEGVYWHLQPLPFPHTLDQI
VKKDMARTGSWMDLRFEIGCLGSYTSEMILDELVEEIIMSCRDMVQVEPMQEPSSDNL

Other information
Ka divergence:0.256441KaKs divergence:0.384864
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):2163Length 2 (bp):2157Length divergence:-0.001
MFE 1 (kcal):-605.62MFE 2 (kcal):-622.1MFE divergence0.013