Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45910-AT2G45920
Species:Arabidopsis
Duplication type:TD
Function (paralog1):U-box domain-containing protein kinase family protein
Function (paralog2):U-box domain-containing protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.066270016694136
Log2 mRNA fold difference:-1.035632763841
Log2 TE fold difference:1.4777203166182
Sequences
Protein sequence

MALVSPIPAMGERAGSMRFHGIGSPGSRSSRSGIMDEPVSRLIDEKIFVAVDKHVAKSKS
TLIWALQNTGGKKICLIHVHQPSQMIPLMGAKFPVGAVKEEEVRVFREKEREKVHMILDD
YLRICQQRGVRAEKMFIEMESIENGIVQLISELGIRKLVMGAAADRHYSRRMTDLKSRKA
IFVRREAPTLCQIWFTCKGYLIHTREATMDDTESEYASPRPSISASDLLQTFSTPESEHQ
HISRVQSTDSVQQLVSNGSSTEQSGRVSDGSLNTDEEERESDGSEVTGSATVMSSGHSSP
SSFPDGVDDSFNVKIRKATSEAHSSKQEAFAETLRRQKAEKNALDAIRRAKQSESAYSEE
LKRRKDTEIAVAKEKERFITIKNEQEVIMEELQSAMAQKAMLESQIAKSDGTMEKLNQKL
DIAVKLLQKLRDEREELQTERDRALREAEELRSHAETSTLQLPQYFTDFSFSEIEEATNH
FDSTLKIGEGGYGSIYVGLLRHTQVAIKMLNPNSSQGPVEYQQEVDVLSKMRHPNIITLI
GACPEGWSLVYEYLPGGSLEDRLTCKDNSPPLSWQNRVRIATEICAALVFLHSNKAHSLV
HGDLKPANILLDSNLVSKLSDFGTCSLLHPNGSKSVRTDVTGTVAYLDPEASSSGELTPK
SDVYSFGIILLRLLTGRPALRISNEVKYALDNGTLNDLLDPLAGDWPFVQAEQLARLALR
CCETVSENRPDLGTEVWRVLEPMRASSGGSSSFHLGRNEHRIAPPYFICPIFQEVMQDPH
VAADGFTYEAEAIRAWLDSEHDTSPMTNVKLSHTSLIANHALRSAIQEWLQHHL

MMGKSGSQQLLMDEKIYVAVGSDLGNKSTLVWAIQNTGGKEFCIVHVHQPLYRKEKEKTQ
KILDKYLQKCRQMQVCAEMIHIKMESVEKGIIQLISERNVKKLVMGAASDTRYSMRMADL
LSTKAIYIRQEAPATCCIWFTCKGYLVYKRESIMGNTSLEYASTSSGQDSVRSRGSVIPS
RQFTISRGNGNVYQLAVFEAEKSKKEASLEAFKHQEVVKEKNEAIKRGKEWESAYLEELK
QRKETEMELKKVREKLEKMRYISENRITESYMLVQKLQDKYNLATKVLRKAKEERDLLIK
GRDIAIIEVEELRKEVSRSDEHREAPQYFICPISLEVMKDPQLAADGFTYEAEAISTWLQ
GGHETSPMTNTKLHHTKLVPNLALRSAIQEWLHASSSFRK

Other information
Ka divergence:0.324185KaKs divergence:-0.400659
GC content 1 (%):45GC content 2 (%):42GC content divergence:-0.034
Length 1 (bp):2505Length 2 (bp):1203Length divergence:-0.351
MFE 1 (kcal):-776.49MFE 2 (kcal):-349.67MFE divergence-0.379