Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45910-AT3G61410
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):U-box domain-containing protein kinase family protein
Function (paralog2):

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.0957224419655
Log2 mRNA fold difference:-1.366959785427
Log2 TE fold difference:0.34431417819701
Sequences
Protein sequence

MALVSPIPAMGERAGSMRFHGIGSPGSRSSRSGIMDEPVSRLIDEKIFVAVDKHVAKSKS
TLIWALQNTGGKKICLIHVHQPSQMIPLMGAKFPVGAVKEEEVRVFREKEREKVHMILDD
YLRICQQRGVRAEKMFIEMESIENGIVQLISELGIRKLVMGAAADRHYSRRMTDLKSRKA
IFVRREAPTLCQIWFTCKGYLIHTREATMDDTESEYASPRPSISASDLLQTFSTPESEHQ
HISRVQSTDSVQQLVSNGSSTEQSGRVSDGSLNTDEEERESDGSEVTGSATVMSSGHSSP
SSFPDGVDDSFNVKIRKATSEAHSSKQEAFAETLRRQKAEKNALDAIRRAKQSESAYSEE
LKRRKDTEIAVAKEKERFITIKNEQEVIMEELQSAMAQKAMLESQIAKSDGTMEKLNQKL
DIAVKLLQKLRDEREELQTERDRALREAEELRSHAETSTLQLPQYFTDFSFSEIEEATNH
FDSTLKIGEGGYGSIYVGLLRHTQVAIKMLNPNSSQGPVEYQQEVDVLSKMRHPNIITLI
GACPEGWSLVYEYLPGGSLEDRLTCKDNSPPLSWQNRVRIATEICAALVFLHSNKAHSLV
HGDLKPANILLDSNLVSKLSDFGTCSLLHPNGSKSVRTDVTGTVAYLDPEASSSGELTPK
SDVYSFGIILLRLLTGRPALRISNEVKYALDNGTLNDLLDPLAGDWPFVQAEQLARLALR
CCETVSENRPDLGTEVWRVLEPMRASSGGSSSFHLGRNEHRIAPPYFICPIFQEVMQDPH
VAADGFTYEAEAIRAWLDSEHDTSPMTNVKLSHTSLIANHALRSAIQEWLQHHL

MEEKEEAGVMDERIYVALGREIANNKSNLAWVLDNCQGNKICIVLVHRPPQMIPVLGTKF
DAATVDEELVRAYREKQKAKTDKILDEYLRICLRKGVQAEKLCVEMNSIEKGIVQMISEN
KVRKFIMGAASDKHFSTKMEDLRSKKAIFVCQQASATCHIRFTCKGYLIHTREARMDEVR
ALSALLSDFQRLVTSQSSANLDQDSGGSKRKSEHEEGEEEERTSRTSSSRSASTLSYFGG
SEASSSVSVMEEISNRSSPPSLPCSGMGLGMITFLINSTKLWQRLAIQNHKHCE

www.000webhost.com

Other information
Ka divergence:0.418554KaKs divergence:-0.144512
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):2505Length 2 (bp):885Length divergence:-0.478
MFE 1 (kcal):-776.49MFE 2 (kcal):-242.03MFE divergence-0.525