Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45920-AT3G61390
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):U-box domain-containing protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.6924223696222
Log2 mRNA fold difference:-1.8613946423981
Log2 TE fold difference:0.3547024974039
Sequences
Protein sequence

MMGKSGSQQLLMDEKIYVAVGSDLGNKSTLVWAIQNTGGKEFCIVHVHQPLYRKEKEKTQ
KILDKYLQKCRQMQVCAEMIHIKMESVEKGIIQLISERNVKKLVMGAASDTRYSMRMADL
LSTKAIYIRQEAPATCCIWFTCKGYLVYKRESIMGNTSLEYASTSSGQDSVRSRGSVIPS
RQFTISRGNGNVYQLAVFEAEKSKKEASLEAFKHQEVVKEKNEAIKRGKEWESAYLEELK
QRKETEMELKKVREKLEKMRYISENRITESYMLVQKLQDKYNLATKVLRKAKEERDLLIK
GRDIAIIEVEELRKEVSRSDEHREAPQYFICPISLEVMKDPQLAADGFTYEAEAISTWLQ
GGHETSPMTNTKLHHTKLVPNLALRSAIQEWLHASSSFRK

MTLKIPIQEMVKMVGSLRSHGIDIPESMEINKKEKIYVAVTEKDLESKSSLVWAIQNSGG
KEFCIVHVHQPIPGEMFHEQKLRLYRKEKDKAHKNSEKYLQICRQMQVTAEIIYIETDSV
EKGILQLISQRGVTKLVMGAAADRHYSMRMRDLKSKKAIYIHREAPATCLIWFTCNGYLI
CSREARRANNLYLECASSNSLSQSDITRGTESIVKDDDHLIKLAVTEAEASKRKARFEAC
KREEAEKTAVDALKKAKQWENVYFEELKQRKETEKALRKRNDELEKMRSESETQITESYT
VIRKLQEKNNLSMETFRGIREEQEELKIKLREVSKLKGKREEEEASTSNHREPPQYFICP
ITHDIMEDPHVAADGFTYEGEAISRWFERGHETSPMINKRLPHTSLVPNLALRSAIQEWL
QLRELLNRPSACREI

Other information
Ka divergence:-0.112576KaKs divergence:-0.999667
GC content 1 (%):42GC content 2 (%):40GC content divergence:-0.024
Length 1 (bp):1203Length 2 (bp):1308Length divergence:0.042
MFE 1 (kcal):-349.67MFE 2 (kcal):-326.73MFE divergence-0.034