Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45950-AT3G61415
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SKP1-like 20
Function (paralog2):SKP1-like 21

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.10785472603475
Log2 mRNA fold difference:0.044603892712223
Log2 TE fold difference:-0.098737040558739
Sequences
Protein sequence

MSEGDLAVMKPETMKSYIWLQTADGSIQQVEQEVAMFCPMICQEVIQKGVGSSKNHAISL
PQRVNPAMFSLILDYCRFHQLPGRSNKERKTYDERFIRMDTKRLCELTSAADSLQLKPLV
DLTSRALARIIEGKNPEEIREIFHLPDDLTEEEKLEPLKNSMDDPRIRLLNRLYAKKRKE
LKERERLKNVEVEEHVDERSVDDLLSFINGRDHKAVKMSKGKKKKKKKKDQKIVSSNNIH
DKESHDLRSKQQCVEEIGSSMREVPNLLSAEDDISTPNAGSEDEDIDDEIDPAMRELLDR
EVEDFAQRLNSNWVRSLGKERRPVHFSINGNGTTRRHTGMVSIWRPCMFTLF

MSEGEMAIIKPEMMKSYIWLETADGSIQQVEQEVAMFCPMICQEVIQKGVGSSKNYAISL
PQRVNPAMLSLIFDYCRFHQVPGRSNKERKVYDEKFIRMDTKRLCELTSAADSLQLKPLV
DLTSRALARIIEGKTPEEIREIFHLPDDLTEEEKLEPLKNTMDDPRIRLLNRLYAKKRKE
LKEREKLKSVEVEEHVDERSVDDLLSFINGRDPKVVKTSKSKKKNKKRKEQKNGSSNGTC
EALEKDLHNLDSKSQSAEIVDNTASCLGDVSNLPSMEDDIFTPKTEFEDGYIDDEIDPAL
KELLDREVEDFARRLNSSWVLSIGQERQPVNFSINGNGTSRRLTGPAAGHK

www.000webhost.com

Other information
Ka divergence:-0.233042KaKs divergence:-0.290638
GC content 1 (%):41GC content 2 (%):40GC content divergence:-0.012
Length 1 (bp):1059Length 2 (bp):1056Length divergence:-0.001
MFE 1 (kcal):-282.22MFE 2 (kcal):-281.82MFE divergence-0.001