Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45960-AT3G61430
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):plasma membrane intrinsic protein 1B
Function (paralog2):plasma membrane intrinsic protein 1A

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.5318016297914
Log2 mRNA fold difference:-1.4534003120174
Log2 TE fold difference:0.031799728812007
Sequences
Protein sequence

MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA
TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTIAHGYTKGSGLGA
EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL
GAAIIFNKDNAWDDHVMGLLGWTIHWCCTCCSLPRYSHQSHPIQVQKLKLIEFYLKSGFC
S

MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPFFEPGELSSWSFWRAGIAEFIA
TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
LFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAHGYTKGSGLGA
EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL
GAAIIYNKDHSWDDHWVFWVGPFIGAALAALYHVVVIRAIPFKSRS

Other information
Ka divergence:-0.742954KaKs divergence:-0.769231
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):906Length 2 (bp):861Length divergence:-0.025
MFE 1 (kcal):-303.3MFE 2 (kcal):-280.74MFE divergence-0.039