Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46110-AT3G61530
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ketopantoate hydroxymethyltransferase 1
Function (paralog2):Phosphoenolpyruvate carboxylase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.31295612487006
Log2 mRNA fold difference:1.4376464828667
Log2 TE fold difference:-1.5628183184976
Sequences
Protein sequence

MASSLTRNCSRFSKAISVRFMSNLPENTVYGGPKPQNPNQRVTLTHLRQKHRRGEPITVV
TAYDYPSAVHLDTAGIDVCLVGDSASMVVHGHDTTLPISLDEMLVHCRAVARGAKRPLLV
GDLPFGTYESSSSQAVDTAVRVLKEGGMDAIKLEGGSASRITAAKAIVEAGIAVIGHVGL
TPQAISVLGGFRPQGRNIASAVKVVETAMALQEAGCFSVVLECVPPPVAAAATSALKIPT
IGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQYANVGEVINKALMEYKEEVSKK
VFPGPSHSPYKITASELDGFLTELQKLGFDKAASAAALAAENMEPSK

MAASLVRSCCSRASRAITTVRFMSNVPEDTVYGGPKPQNSNQRVTLTQLRQKHRKGEPIT
MVTAYDYPSAVHIDTAGIDVCLVGDSAAMVVHGYDTTLPISLEEMLVHCRAVARGAKRPL
LVGDLPFGTYESSTNQAVDTAVRVLKEGGMDAIKLEGGSPSRITAAKSIVEAGIAVMGHV
GLTPQAISVLGGFRPQGKNIASAVKVVETAMALQEAGCFSVVLECVPPPVAAAATSALNI
PTIGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQYAQVGEVINKALLEYKEEVS
KHLFPGPSHSPYKISSSDLDGFLSELQKLGLDKAASDAAASAEKMDHSDSPSSQ

Other information
Ka divergence:0.117544KaKs divergence:0.624154
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1044Length 2 (bp):1065Length divergence:0.01
MFE 1 (kcal):-333.8MFE 2 (kcal):-361.8MFE divergence0.04