Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46160-AT3G61550
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.97751311525475
Log2 mRNA fold difference:2.0278337182485
Log2 TE fold difference:-0.97721601886892
Sequences
Protein sequence

MSTLASSASVFLVHPPLPPSPPQAGNHSYLTTLGFGYSIAIALGFLVLLSTVLLSSYICC
RDSRRRTTAVESTGDRGGSVILPRIIFVAEEDNEDLEAGDVVVGLDQAVINSYPKFHFSK
DTSAASSDGFGGGGDTTCSICLCEYKEAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCR
NSPLPTPTSTPLSTPLSEVVPLSQYAADRRRARR

MSTATLVVFPPPPPVPIPTYITSLGLGYSIAIALGFLVLISTIILSSYICCRASRLRFSA
SAANANANASFSDRGVIVPRIIFVAEDDDLESGNVVVGGLDHSVINSYPKFHFTKDITAV
VNGDGFHDGEGRETTCSICLCEYMEEEMLRMMPECKHYFHVYCLDAWLKLNGSCPVCRNS
PLPTPQSTPQSTPLSEVVPLSQYAADRRRSRR

www.000webhost.com

Other information
Ka divergence:0.371055KaKs divergence:0.136428
GC content 1 (%):53GC content 2 (%):49GC content divergence:-0.039
Length 1 (bp):645Length 2 (bp):639Length divergence:-0.005
MFE 1 (kcal):-203.39MFE 2 (kcal):-173.79MFE divergence-0.078