Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46170-AT3G61560
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Reticulon family protein
Function (paralog2):Reticulon family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.5881150692467
Log2 mRNA fold difference:-1.5063116831411
Log2 TE fold difference:-0.1090038669308
Sequences
Protein sequence

MAEEIEKSVPTEESLMEKISEKIHHHDSSSSSESEYEKPDSPSAVKAKIYRMFGREKPVH
KVLGGGKPADVFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWS
NAHTLINKTSPQIPEIHVPEEAFLVVASSLRNELNQAFVILRSIALGRDLKKFLMVVVGL
WIISVVGNWFNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVL
SKIPIASLKAKAKLG

MAEELEKSMHKEESLMEKIADKIHDHDSSSSSDSEHEKPESPSALKAKIYRLFGREKPVH
KVLGGGLPADVFLWRDKKLSASVLGVATAIWVLFELVEYHFLSLVCHILIFALAALFLLS
NAHAFMNKGTFPYDCFCTEKRAEPGLCYFKEHCLRKGLEEISHELIQSTYETFSIMGFVT
RTSIYIGISGGFWAVDNLGCGKLVQLLDSCFVVLHTVPMLYEKHEDKVDPVAEKTLKELK
KHYMVFDEKVLSKLPVASLKAKLG

www.000webhost.com

Other information
Ka divergence:0.620914KaKs divergence:0.665779
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):768Length 2 (bp):795Length divergence:0.017
MFE 1 (kcal):-223.54MFE 2 (kcal):-231.5MFE divergence0.017