Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46180-AT3G61570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):golgin candidate 4
Function (paralog2):GRIP-related ARF-binding domain-containing protein 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.8918134899741
Log2 mRNA fold difference:-1.3826584479826
Log2 TE fold difference:0.41282819296853
Sequences
Protein sequence

MWSSVANLKENLNKIAHDVHDDDEDDDEDLTIYGSTNGGTDRRNSNGFRYSRSPMANGFE
SPVNPEIERYKAEINKLQKSESEIKALSVNYAALLKEKEDQISRLNQENGSLKQNLTSTN
AALKESRLDLSRASNNNAIKGNGDHSPNRSQRSPTNWKNRNQMNNGIASKPNGTENDSES
HKKEKEFAEMLEERTRSMASAQARELEKEREKSANLQILLQEERKQNETFKEELQSLRLD
KEKTLMESNKVRRELDAKLAEIRQLQMKLNGGEQHAFGISRENLKEVNKALEKENNELKL
KRSELEAALEASQKSTSRKLFPKSTEDLSRHLSSLDEEKAGTFPGKEDMEKSLQRLEKEL
EEARREKDKARQELKRLKQHLLEKETEESEKMDEDSRLIDELRQTNEYQRSQILGLEKAL
RQTMANQEEIKSSSDLEIRKSKGIIEDLNQKLANCLRTIDSKNVELLNLQTALGQYYAEI
EAKEHFERELAVAKEDAMKLSARLKDVDEQLESSKKEKEEITSKVLHAENIAAEWKNRVS
KVEDDNAKVRRVLEQSMTRLNRMSMDSDFLVDRRIVIKLLVTYFQRNHSREVLDLMVRML
GFSEEEKQRIGLAQQGAAGKGVVRGVLGFPGRLVGGILGGGGGSPDSHPNMASDNQSFAD
MWVEFLLKDAEERERREAEDAANKEQEKATVSSTQRPKYEQSDSEFSTVPLTSSNSNHRL
SRLLT

MWSSIENMKANLHKIVLDVHEDDEEEDDLHKYGSANGVSNSDRRNSSGFRSVSRYSISNG
IESPAHHEIERYKAEIKKLQESESDIKALSVNYAALLREKEDQISRLNQENGSLKQNLTS
TSAALKEARTDISRGSNNYAIKGNNDQSPNRLHKSVSHLKSPNHMSNGKGKDTDSFIKEK
DLADMLEDRTKSMAAVQATELAKEREKLRDFQLSLQEERKRSESFKEELESMRLDKNKTS
MEISKMRSELDAKLLEIKHLQMKLTGQESHAIGPGMEHLKEVNKALEKENNELKLKRSEL
EAALEESRKLTNSKVFPDATESLTRHPSTLDKEKPESFPGKEEMEQSLQRLEMDLKETQR
ERDKARQELKRLKQHLLEKETEESEKMDEDSRLIEELRQTNEYQRSQISHLEKSLKQAIS
NQEDNRLSNDNQIRKLKDTVDDLNQKLTNCLRTIESKNVELLNLQTALGQYYAEIEAKEH
FERELAMAKDELMKLSARLKDSDERLESSNKEKEDVTSKLLHAEKVAAEWKNRVTKVEED
NAKVRRVLEQSMTRLNRMSMESDYLVDRRIVIKLLVTYFQKNHNKEVLDLMVRMLGFSEE
DKERIGAAKQGGGKGVVRGVLGFPGRFVGGILGGKSAELHANAASDNQSFADLWVDFLLK
DAEERERREAEEAAASKAKQDSERTRQEAALHDSEFSTVPLRSSESNQRLSR

www.000webhost.com

Other information
Ka divergence:-0.0312054KaKs divergence:0.656641
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):2178Length 2 (bp):2139Length divergence:-0.009
MFE 1 (kcal):-605.7MFE 2 (kcal):-610.14MFE divergence0.004