Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46210-AT3G61580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Fatty acid/sphingolipid desaturase
Function (paralog2):Fatty acid/sphingolipid desaturase

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:4.5978644467236
Log2 mRNA fold difference:5.1633571469012
Log2 TE fold difference:-0.65683405331579
Sequences
Protein sequence

MADQTKKRYVTSEDLKKHNKPGDLWISIQGKVYDVSDWVKSHPGGEAAILNLAGQDVTDA
FIAYHPGTAWHHLEKLHNGYHVRDHHVSDVSRDYRRLAAEFSKRGLFDKKGHVTLYTLTC
VGVMLAAVLYGVLACTSIWAHLISAVLLGLLWIQSAYVGHDSGHYTVTSTKPCNKLIQLL
SGNCLTGISIAWWKWTHNAHHIACNSLDHDPDLQHIPIFAVSTKFFNSMTSRFYGRKLTF
DPLARFLISYQHWTFYPVMCVGRINLFIQTFLLLFSKRHVPDRALNIAGILVFWTWFPLL
VSFLPNWQERFIFVFVSFAVTAIQHVQFCLNHFAADVYTGPPNGNDWFEKQTAGTLDISC
RSFMDWFFGGLQFQLEHHLFPRLPRCHLRTVSPVVKELCKKHNLPYRSLSWWEANVWTIR
TLKNAAIQARDATNPVLKNLLWEAVNTHG

MAEETEKKYITNEDLKKHNKSGDLWIAIQGKVYNVSDWIKTHPGGDTVILNLVGQDVTDA
FIAFHPGTAWHHLDHLFTGYHIRDFQVSEVSRDYRRMAAEFRKLGLFENKGHVTLYTLAF
VAAMFLGVLYGVLACTSVFAHQIAAALLGLLWIQSAYIGHDSGHYVIMSNKSYNRFAQLL
SGNCLTGISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSTKFFSSLTSRFYDRKLTF
DPVARFLVSYQHFTYYPVMCFGRINLFIQTFLLLFSKREVPDRALNFAGILVFWTWFPLL
VSCLPNWPERFFFVFTSFTVTALQHIQFTLNHFAADVYVGPPTGSDWFEKQAAGTIDISC
RSYMDWFFGGLQFQLEHHLFPRLPRCHLRKVSPVVQELCKKHNLPYRSMSWFEANVLTIN
TLKTAAYQARDVANPVVKNLVWEALNTHG

Other information
Ka divergence:0.222337KaKs divergence:-0.368981
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):1350Length 2 (bp):1350Length divergence:0
MFE 1 (kcal):-425MFE 2 (kcal):-396.46MFE divergence-0.035