Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46260-AT3G61600
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):BTB/POZ/Kelch-associated protein
Function (paralog2):POZ/BTB containin G-protein 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.0227000523553
Log2 mRNA fold difference:1.0354985590002
Log2 TE fold difference:0.18244620065126
Sequences
Protein sequence

MRGSNNTDLFDPKTEMDSNFSRHGSSSEGDFGFAFNDSNFSDRLLRIEILGGPSDSRSDA
EGCTSIADWARHRKRRREDNKKDNGVAISDIVACAEEQILTDNNQPDMDDAPGGDNLDDE
GEAMVEEALSGDDDASSEPNWGIDCSTVVRVKELHISSPILAAKSPFFYKLFSNGMRESE
QRHVTLRISAQEEGALMELLNFMYSNSLSVTTAPALLDVLMAADKFEVASCMRYCSRLLR
NMPMTPDSALLYLELPSSVLMAEAVQPLTDAAKQFLASRYKDITKFHDEVMALPLAGIEA
ILSSDDLQIASEDAVYDFVLKWARGQYSSLEDRREILGSRLALYIRFPYMTCRKLKKVLT
CSDFEHEVASKQVLEALFFKAEAPHRQRILAAEGSDSMNRRFIERAYKYRPVKVVEFELP
RPQCVVYLDLKREECAGLFPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQ
EKGAVSFGVDYEFAARDKSTKEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSQH
FINGILHLRAELTIKRSSDLH

MRGTTENTDLFDPKTQMDPDFTRHGSSSDGDFGFAFNDSNFSDRLLRIEIMGGPSDSRSE
VEGCTSIADWARHRKRRREDIKKESGVTISDIVACPEEQILTDEQPDMDGCPGGENPDDE
GGEAMVEEALSGDEEETSSEPNWGMDCSTVVRVKELHISSPILAAKSPFFYKLFSNGMRE
SEQRHVTLRINASEEAALMELLNFMYSNAVSVTTAPALLDVLMAADKFEVASCMRYCSRL
LRNMPMTPESALLYLELPSSVLMAKAVQPLTDAAKQFLAARYKDITKFHEEVMSLPLAGI
EAILSSDELQIASEDAVYDFILKWARAQYPCLEERREILGSRLALSIRFPFMTCRKLKKV
LTCSDFEHEIASKLVLEALFFKAEAPHRQRSLASEESASLNRRLIERAYKYRPVKVVEFE
LPRPQCVVYLDLKREECGGLFPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLG
MQEKGSVSFGVDYEFSARSKPAEDFISKYKGNYTFTGGKAVGYRNLFGVPWTSFIAEDSQ
YFINGILHLRAELTIKRSTDP

www.000webhost.com

Other information
Ka divergence:-0.0135064KaKs divergence:-0.665421
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1686Length 2 (bp):1686Length divergence:0
MFE 1 (kcal):-518.02MFE 2 (kcal):-550.83MFE divergence0.031