Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46280-AT2G46290
Species:Arabidopsis
Duplication type:TD
Function (paralog1):TGF-beta receptor interacting protein 1
Function (paralog2):Transducin/WD40 repeat-like superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.1439346185134
Log2 mRNA fold difference:-1.4698562879414
Log2 TE fold difference:-0.6035945512304
Sequences
Protein sequence

MRPILMKGHERPLTFLRYNREGDLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDV
SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFAVGDRLAVITTDHFVDRTA
AIHVKRIAEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRIWDAETG
KLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLLKTYTTVVPVNAV
SLSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP
DGKSFSSGGEDGYVRLHHFDSDYFNIKI

MTIECVNPEGLRFNQMKSSSHQTLETRMRPILMKGHERPLTFLRYNRNGDLLFSCAKDHT
PTVWFADNGERLGTYRGHSGAVWCCDISRDSSRLITGSADQTAKLWDVKSGKELFTFKFG
APARSVDFSVGDHLAVITTDHFVGTSSAIHVKRIAEDPEDQVGDSVLVLQSPDGKKKINR
AVWGPLNQTIVSGGEDAAIRIWDAETGKLLKQSDEEVGHKEAITSLCKAADDSHFLTGSH
DKTAKLWDMRTLTLIKTYTTVVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAK
FYDTILQEEIGGVKGHFGPINALAFSPDGKSFSSGGEDGYVRLHHFDSNYFNIKI

www.000webhost.com

Other information
Ka divergence:0.179457KaKs divergence:0.339028
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):987Length 2 (bp):1068Length divergence:0.039
MFE 1 (kcal):-314.9MFE 2 (kcal):-346.32MFE divergence0.048