Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46310-AT3G61630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cytokinin response factor 5
Function (paralog2):cytokinin response factor 6

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.3242885225587
Log2 mRNA fold difference:1.5152663340123
Log2 TE fold difference:-0.1535873395651
Sequences
Protein sequence

MKSRVRKSKYTVHRKITSTPFDGFPKIVKIIVTDPCATDSSSDEENDNKSVAPRVKRYVD
EIRFCDEDDEPKPARKAKKKSPAAAAENGGDLVKSVVKYRGVRQRPWGKFAAEIRDPSSR
TRLWLGTFATAEEAAIGYDRAAIRIKGHNAQTNFLTPPPSPTTEVLPETPVIDLETVSGC
DSARESQISLCSPTSVLRFSHNDETEYRTEPTEEQNPFFLPDLFRSGDYFWDSEITPDPL
FLDEFHQSLLPNINNNNTVCDKDTNLSDSFPLGVIGDFSSWDVDEFFQDHLLDK

MERRTRRVKFTENRTVTNVAATPSNGSPRLVRITVTDPFATDSSSDDDDNNNVTVVPRVK
RYVKEIRFCQGESSSSTAARKGKHKEEESVVVEDDVSTSVKPKKYRGVRQRPWGKFAAEI
RDPSSRTRIWLGTFVTAEEAAIAYDRAAIHLKGPKALTNFLTPPTPTPVIDLQTVSACDY
GRDSRQSLHSPTSVLRFNVNEETEHEIEAIELSPERKSTVIKEEEESSAGLVFPDPYLLP
DLSLAGECFWDTEIAPDLLFLDEETKIQSTLLPNTEVSKQGENETEDFEFGLIDDFESSP
WDVDHFFDHHHHSFD

www.000webhost.com

Other information
Ka divergence:-0.111435KaKs divergence:0.420463
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):885Length 2 (bp):948Length divergence:0.034
MFE 1 (kcal):-286.74MFE 2 (kcal):-302.06MFE divergence0.026