Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46330-AT3G61640
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):arabinogalactan protein 16
Function (paralog2):arabinogalactan protein 20

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-2.2859361528659
Log2 mRNA fold difference:-1.5599600780356
Log2 TE fold difference:-0.75688865841438
Sequences
Protein sequence

MASRNSVTGFALFSFVFAVILSLAGAQSLAPAPAPTSDGTSIDQGIAYLLMVVALVLTYL
IHPLDASSSYSFF

MASRNSVAVIALFAFVFAVISPFAGAQSLAPAPSPTSDGTSIDQGIAYLLMVVALVLTYL
IHPLDASSSSYTFF

Other information
Ka divergence:-0.195293KaKs divergence:-0.987471
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):222Length 2 (bp):225Length divergence:0.007
MFE 1 (kcal):-58.6MFE 2 (kcal):-50.84MFE divergence-0.071