Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46380-AT3G61670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF3133)
Function (paralog2):Protein of unknown function (DUF3133)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.5440636693001
Log2 mRNA fold difference:1.4265125127117
Log2 TE fold difference:0.18485542497302
Sequences
Protein sequence

MAESSTIEARLVRCPKCKNLLQEPKDCPFFQCGGCGTVLCAKNKDREADLLSVKSVENRS
KEIEVTSGSSEEESDSNASLRHQQDGQTETWDVHNDPSSKMNVVDSGNNDSQPGLDQIRK
RTTKRCDLEGFRFSTSNYFTDSLSTDEAIEQDRAGLVRKLDKLKEQLVQPKEQQIPSSSS
GFQKAPLRVFSSGRRIAGPSYYQYYSEPEPPCLYNNNSDVSLHGPMHNPANVPAYGDPHG
FPMHERTLQPSHLHNSRQYIGNNGHDVFDTHPHNGMFHQSTCSCTHCYDPYHRASGSVFP
PSGLPDALRNPGFYPHERSFGFGTSLHSPRTFIPPGSQSPGPQLRGRCTSGFKDMRMNAV
SRVHPSKPVSSSGGSRLIQPVAGGAPFINCINCFKLLKLPEKIDSATRKKQRMRCGACSC
VIDYSFVDKKLILSTDPASARKPETHSRLRWETTANFSSDDYDNAAYEFHAMDRGSADVS
TALVLISNTAQEMQITDATSPSVSEDELSSDSSTVRKVNLASPLHKQFEYSSINVRDRSG
PRSQSSRSEQDRVTLSKTAMRQNSMKEASVAIEMDVNDYSHNNEVSQDSANDCTDDQGRT
KKGGFASIMKNSFKDLKKSIQNEGRSDVSINGHPVAERLVKMAEKQAGPIRPGNYWYDYR
AGFWGVLGSHCLGILPPFIEELNYPMPENCAGGTTRVFVNGRELHQKDLRLLTARGLPRD
RDRSYTVYISGRVIDEDTGEELDSLGKLAPTVDKLKRGFGMRVPRRAT

MADSTKVRLVRCPKCENLLSEPEDSPFFQCGGCFTVLRAKTKEREADSVSVKSVEDTAKP
VSASSPEKAILDSSETSSDSDVPSLRHHHNVVPVDVESDPCSKPSSLEQGNRSILLGDKD
DLKSQSGRQQDSGWDRFRKRTTKRCDSQSVINRLSTSRHPCDEGTSSSANYFPDSLLEFQ
KHLKDQSNEAIEQDRAGLLRQLEKIKEQLVQSCNVATDKSKEQAPSSSSASGLNKAPPMR
FHSTGNHAVGGPSYYHQPQFPYNNNNINEAPMHHSLMHPSYGDPHRFPIHGRGPHPYFSG
QYVGNNNNGHDLFDAYPQQNGHFHHSSCSCYHCYDNKYWRGSAPVVPDAPYNAGFYPHES
VMGFAPPHNPRTYGSRGLQPHGRWPSNFSDAQMDALSRIRPPKVVLSGGSRHIRPLAGGA
PFITCQNCFELLQLPKKPEAGTKKQQKVRCGACSCLIDLSVVNNKFVLSTNTASTRQGEA
RVAADYTSDDYDLLGYVFHSLDDEPRDLPGLISDKSQDMQHVHSHSASLSEGELSSDSLT
AKPLAEAHENFVDYSSINHDRSGAGSRSSRSEHDKVTLSKATAMRQNSMKEVSLASEMEV
NFNDYSHRNSGVSKDQQQRAKKSGFASIVKKSFKDLTKSIQNDEGNKSNVSINGHPLTER
LLRKAEKQAGVIQPGNYWYDYRAGFWGVMGGPGLGILPPFIEELNYPMPENCSGGTTGVF
VNGRELHRKDLDLLAGRGLPPDRDRSYIVDITGRVIDEDTGEELDCLGKLAPTIEKLKRG
FGMRLPKRTT

www.000webhost.com

Other information
Ka divergence:-0.0993438KaKs divergence:-0.397524
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):2307Length 2 (bp):2373Length divergence:0.014
MFE 1 (kcal):-674.11MFE 2 (kcal):-727.26MFE divergence0.038