Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46420-AT3G61700
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant protein 1589 of unknown function
Function (paralog2):Plant protein 1589 of unknown function

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.3878006396568
Log2 mRNA fold difference:0.20621256636766
Log2 TE fold difference:0.17266296848317
Sequences
Protein sequence

MKNGQELQSSTQVSHESQGEQKVNLSVEAPIQDSGSVSASSNDGRKVSRQDIELVQNLIE
RCLQLYMSRDEVVKTLLTRARIDPGFTTLVWQKLEEENAEFFRAYYIRLKLKKQIVVFNH
LLEHQYHLTKYNVHSKVPLVPMQNGIHPMASVNNMPMGYPVLQHPQMHAQGHPHLDPMSC
GMSSCHVVNGVPAPANFQPMRINSGNDMVIDTTMAEPTPMIPPNSGMSDMPVSPASVASS
GHFPFAASDMSGMGMDTSALDSAFTSDVGTSVGLQLGSDGGAGNSRDPLRPFDQIPWNFS
LSDLTADLSNLGDLGALGNYPGSPFLPSDSEILLDSPEQEDIDEFFVDSIPGPPCSQSEE
DKS

MKNGQCAQELQSSTQASHDSQGDQKTNLSIDAPIQDSGSVSASSNDSRKVSRQDIELVQN
LIERCLQLYMNRDEVVKTLLTRARIDPGFTTLVWQKLEEENADFFRAYYIRLKLKKQIIL
FNHLLEHQYHLMKYPPGPPKVPLAPIQNGMHPMAPVNMPMGYPVLQHPQMHVPGHPHHLD
AMGVSSCHVVNGVPAPANFHPLRMNTANDMVIDTTANDATPQVIPPNSGAMPEMVASPAS
VASSGHFPFAASDMSGMVMDTSVLDSAFTSDVGPDGEGAGNSRDSLRSFDQIPWNFSLSD
LTADLSNLGDMYVADLGALGNYPGSPFLPSDSEIFLDSPEQEDIEEFFVDSVPGPRSNSD
EEKP

www.000webhost.com

Other information
Ka divergence:-0.354161KaKs divergence:-0.0694197
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1092Length 2 (bp):1095Length divergence:0.001
MFE 1 (kcal):-314.29MFE 2 (kcal):-324.9MFE divergence0.017