Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46430-AT2G46440
Species:Arabidopsis
Duplication type:TD
Function (paralog1):cyclic nucleotide gated channel 3
Function (paralog2):cyclic nucleotide-gated channels

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.44604006685743
Log2 mRNA fold difference:1.9427620824106
Log2 TE fold difference:-1.4673663847251
Sequences
Protein sequence

MMNPQRNKFVRFNGNDDEFSTKTTRPSVSSVMKTVRRSFEKGSEKIRTFKRPLSVHSNKN
KENNKKKKILRVMNPNDSYLQSWNKIFLLLSVVALAFDPLFFYIPYVKPERFCLNLDKKL
QTIACVFRTFIDAFYVVHMLFQFHTGFITPSSSGFGRGELNEKHKDIALRYLGSYFLIDL
LSILPIPQVVVLAIVPRMRRPASLVAKELLKWVIFCQYVPRIARIYPLFKEVTRTSGLVT
ETAWAGAALNLFLYMLASHVFGSFWYLISIERKDRCWREACAKIQNCTHAYLYCSPTGED
NRLFLNGSCPLIDPEEITNSTVFNFGIFADALQSGVVESRDFPKKFFYCFWWGLRNLSAL
GQNLKTSAFEGEIIFAIVICISGLVLFALLIGNMQKYLQSTTVRVEEMRVKRRDAEQWMS
HRMLPDDLRKRIRKYEQYKWQETKGVEEEALLSSLPKDLRKDIKRHLCLKLLKKVPWFQA
MDDRLLDALCARLKTVLYTEKSYIVREGEPVEDMLFIMRGNLISTTTYGGRTGFFNSVDL
VAGDFCGDLLTWALDPLSSQFPISSRTVQALTEVEGFLLSADDLKFVATQYRRLHSKQLR
HMFRFYSVQWQTWAACFIQAAWKRHCRRKLSKALREEEGKLHNTLQNDDSGGNKLNLGAA
IYASRFASHALRNLRANAAARNSRFPHMLTLLPQKPADPEFPMDET

MNLQRRKFVRLDSTGVDGKLKSVRGRLKKVYGKMKTLENWRKTVLLACVVALAIDPLFLF
IPLIDSQRFCFTFDKTLVAVVCVIRTFIDTFYVIHIIYYLITETIAPRSQASLRGEIVVH
SKATLKTRLLFHFIVDIISVLPIPQVVVLTLIPLSASLVSERILKWIILSQYVPRIIRMY
PLYKEVTRAFGTVAESKRVGAALNFFLYMLHSYVCGAFWYLSSIERKSTCWRAACARTSD
CNLTVTDLLCKRAGSDNIRFLNTSCPLIDPAQITNSTDFDFGMYIDALKSGVLEVKPKDF
PRKFVYCFWWGLRNISALGQNLETSNSAGEIFFAIIICVSGLLLFAVLIGNVQKYLQSST
TRVDEMEEKKRDTEKWMSYREIPEYLKERIRRFEDYKWRRTKGTEEEALLRSLPKDLRLE
TKRYLFLKLLKKVPLLQAMDDQLLDALCARLKTVHYTEKSYIVREGEPVEDMLFIMRGNL
ISTTTYGGRTGFFNSVDLIAGDSCGDLLTWALYSLSSQFPISSRTVQALTEVEGFVISAD
DLKFVATQYRRLHSKQLQHMFRFYSLQWQTWAACFIQAAWKRHCRRKLSKALREEEGKLH
NTLQNDDSGGNKLNLGAAIYA

www.000webhost.com

Other information
Ka divergence:0.526553KaKs divergence:0.67504
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):2121Length 2 (bp):1866Length divergence:-0.064
MFE 1 (kcal):-622.25MFE 2 (kcal):-545.35MFE divergence-0.066