Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46530-AT3G61830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):auxin response factor 11
Function (paralog2):auxin response factor 18

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.73372870847188
Log2 mRNA fold difference:-0.3789261506024
Log2 TE fold difference:1.1020922663009
Sequences
Protein sequence

MSQTSLEPLIISIIKLQILQLWLKLIAVGWNLGSNDDELYTELWKACAGPLVEVPRYGER
VFYFPQGHMEQLVASTNQGVVDQEIPVFNLPPKILCRVLSVTLKAEHETDEVYAQITLQP
EEDQSEPTSLDPPLVEPAKPTVDSFVKILTASDTSTHGGFSVLRKHATECLPSLDMTQPT
PTQELVARDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFLRGETGDLR
VGVRRLAKQQSTMPASVISSQSMRLGVLATASHAVTTTTIFVVFYKPRISQFIISVNKYM
MAMKNGFSLGMRYRMRFEGEESPERIFTGTIIGSGDLSSQWPASKWRSLQIQWDEPSSIQ
RPNKVSPWEIEPFSPSALTPTPTQQQSKSKRSRPISEITGSPVASSFLSSFSQSHESNPS
VKLLFQDPATERNSNKSVFSSGLQCKITEAPVTSSCRLFGFDLTSKPASATIPHDKQLIS
VDSNISDSTTKCQDPNSSNSPKEQKQQTSTRSRIKVQMQGTAVGRAVDLTLLRSYDELIK
ELEKMFEIEGELSPKDKWAIVFTDDEGDRMLVGDDPWNEFCKMAKKLFIYPSDEVKKMRS
KSLLGDKGTIVNLESDQRTVHV

MASVEGDDDFGSSSSRSYQDQLYTELWKVCAGPLVEVPRAQERVFYFPQGHMEQLVASTN
QGINSEEIPVFDLPPKILCRVLDVTLKAEHETDEVYAQITLQPEEDQSEPTSLDPPIVGP
TKQEFHSFVKILTASDTSTHGGFSVLRKHATECLPSLDMTQATPTQELVTRDLHGFEWRF
KHIFRGQPRRHLLTTGWSTFVSSKRLVAGDAFVFLRGENGDLRVGVRRLARHQSTMPTSV
ISSQSMHLGVLATASHAVRTTTIFVVFYKPRISQFIVGVNKYMEAIKHGFSLGTRFRMRF
EGEESPERIFTGTIVGSGDLSSQWPASKWRSLQVQWDEPTTVQRPDKVSPWEIEPFLATS
PISTPAQQPQSKCKRSRPIEPSVKTPAPPSFLYSLPQSQDSINASLKLFQDPSLERISGG
YSSNNSFKPETPPPPTNCSYRLFGFDLTSNSPAPIPQDKQPMDTCGAAKCQEPITPTSMS
EQKKQQTSRSRTKVQMQGIAVGRAVDLTLLKSYDELIDELEEMFEIQGQLLARDKWIVVF
TDDEGDMMLAGDDPWNEFCKMAKKIFIYSSDEVKKMTTKLKISSSLENEEYGNESFENRS
RG

www.000webhost.com

Other information
Ka divergence:0.183894KaKs divergence:0.0733287
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1869Length 2 (bp):1809Length divergence:-0.016
MFE 1 (kcal):-530.58MFE 2 (kcal):-523.83MFE divergence-0.006