Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46590-AT3G61850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Dof-type zinc finger DNA-binding family protein
Function (paralog2):Dof-type zinc finger DNA-binding family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.23845071025311
Log2 mRNA fold difference:-0.6633497841175
Log2 TE fold difference:0.42862212981343
Sequences
Protein sequence

MDATKWTQGFQEMMNVKPMEQIMIPNNNTHQPNTTSNARPNTILTSNGVSTAGATVSGVS
NNNNNTAVVAERKARPQEKLNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSL
RNVPVGGSSRKNKRSSSSSSSNILQTIPSSLPDLNPPILFSNQIHNKSKGSSQDLNLLSF
PVMQDQHHHHVHMSQFLQMPKMEGNGNITHQQQPSSSSSVYGSSSSPVSALELLRTGVNV
SSRSGINSSFMPSGSMMDSNTVLYTSSGFPTMVDYKPSNLSFSTDHQGLGHNSNNRSEAL
HSDHHQQGRVLFPFGDQMKELSSSITQEVDHDDNQQQKSHGNNNNNNNSSPNNGYWSGMF
STTGGGSSW

MDATKWTQGFQEMINVKPMEQMISSTNNNTPQQQPTFIATNTRPNATASNGGSGGNTNNT
ATMETRKARPQEKVNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVG
GSSRKNKRSSTPLASPSNPKLPDLNPPILFSSQIPNKSNKDLNLLSFPVMQDHHHHGMSH
FFHMPKIENNNTSSSIYASSSPVSALELLRSNGVSSRGMNTFLPGQMMDSNSVLYSSLGF
PTMPDYKQSNNNLSFSIDHHQGIGHNTINSNQRAQDNNDDMNGASRVLFPFSDMKELSST
TQEKSHGNNTYWNGMFSNTGGSSW

www.000webhost.com

Other information
Ka divergence:0.162833KaKs divergence:0.274892
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1110Length 2 (bp):975Length divergence:-0.065
MFE 1 (kcal):-273.93MFE 2 (kcal):-236.55MFE divergence-0.073