Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46660-AT3G61880
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cytochrome P450, family 78, subfamily A, polypeptide 6
Function (paralog2):cytochrome p450 78a9

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.1341843428936
Log2 mRNA fold difference:-2.0986394486454
Log2 TE fold difference:0.93122651575864
Sequences
Protein sequence

MATKLESSLIFALLSKCSVLSQTNLAFSLLAVTIIWLAISLFLWTYPGGPAWGKYLFGRL
ISGSYKTGNVIPGPKGFPLVGSMSLMSSTLAHRRIADAAEKFGAKRLMAFSLGETRVIVT
CNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPHGVYWRTLRRIASNHLFSTKQIR
RAETQRRVISSQMVEFLEKQSSNEPCFVRELLKTASLNNMMCSVFGQEYELEKNHVELRE
MVEEGYDLLGTLNWTDHLPWLSEFDPQRLRSRCSTLVPKVNRFVSRIISEHRNQTGDLPR
DFVDVLLSLHGSDKLSDPDIIAVLWEMIFRGTDTVAVLIEWILARMVLHPDMQSTVQNEL
DQVVGKSRALDESDLASLPYLTAVVKEVLRLHPPGPLLSWARLAITDTIVDGRLVPAGTT
AMVNMWAVSHDPHVWVDPLEFKPERFVAKEGEVEFSVLGSDLRLAPFGSGRRICPGKNLG
FTTVMFWTAMMLHEFEWGPSDGNGVDLSEKLRLSCEMANPLPAKLRRRRS

MATKLDTSSLLLALLSKCSLLTQTNLALSLLVASLASLALSLFFWSHPGGPAWGKYFLHR
RRQTTVIPGPRGLPFVGSMSLMSNTLAHRCIAATAEKFRAERLMAFSLGETRVIVTCNPD
VAKEILNSPVFADRPVKESAYSLMFNRAIGFAPYGVYWRTLRKIASNHLFSPKQIKRSET
QRSVIANQIVKCLTKQSNTKGLCFARDLIKTASLNNMMCSVFGKEYELEEEHEEVSELRE
LVEEGYDLLGTLNWTDHLPWLSEFDPQRIRSRCSNLVPKVNRFVNRIISDHREQTRDSPS
DFVDVLLSLDGPDKLSDPDIIAVLWEMIFRGTDTVAVLIEWILARMVLHPDIQSTVHNEL
DQIVGRSRAVEESDVVSLVYLTAVVKEVLRLHPPGPLLSWARLAITDTIIDGRRVPAGTT
AMVNMWAIAHDPHVWENPLEFKPERFVAKEGEVEFSVLGSDLRLAPFGSGRRVCPGKNLG
LTTVTFWTATLLHEFEWLTPSDEKTVDLSEKLRLSCEMANPLAAKLRPRRSFSQKNKIKN
KESKGNKKKESYKKY

Other information
Ka divergence:0.0373206KaKs divergence:-0.00257954
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):1593Length 2 (bp):1668Length divergence:0.023
MFE 1 (kcal):-531.35MFE 2 (kcal):-530.08MFE divergence-0.001