Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46680-AT3G61890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):homeobox 7
Function (paralog2):homeobox 12

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.36875069163755
Log2 mRNA fold difference:1.0204033019621
Log2 TE fold difference:-0.64909605997051
Sequences
Protein sequence

MTEGGEYSPAMMSAEPFLTMKKMKKSNHNKNNQRRFSDEQIKSLEMMFESETRLEPRKKV
QLARELGLQPRQVAIWFQNKRARWKSKQLETEYNILRQNYDNLASQFESLKKEKQALVSE
LQRLKEATQKKTQEEERQCSGDQAVVALSSTHHESENEENRRRKPEEVRPEMEMKDDKGH
HGVMCDHHDYEDDDNGYSNNIKREYFGGFEEEPDHLMNIVEPADSCLTSSDDWRGFKSDT
TTLLDQSSNNYPWRDFWS

MEEGDFFNCCFSEISSGMTMNKKKMKKSNNQKRFSEEQIKSLELIFESETRLEPRKKVQV
ARELGLQPRQVAIWFQNKRARWKTKQLEKEYNTLRANYNNLASQFEIMKKEKQSLVSELQ
RLNEEMQRPKEEKHHECCGDQGLALSSSTESHNGKSEPEGRLDQGSVLCNDGDYNNNIKT
EYFGFEEETDHELMNIVEKADDSCLTSSENWGGFNSDSLLDQSSSNYPNWWEFWS

Other information
Ka divergence:0.134381KaKs divergence:0.0540301
GC content 1 (%):44GC content 2 (%):41GC content divergence:-0.035
Length 1 (bp):777Length 2 (bp):708Length divergence:-0.046
MFE 1 (kcal):-227.83MFE 2 (kcal):-195.2MFE divergence-0.077