Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46690-AT3G61900
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SAUR-like auxin-responsive protein family
Function (paralog2):SAUR-like auxin-responsive protein family

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-4.8704031395233
Log2 mRNA fold difference:-5.7921451610034
Log2 TE fold difference:0.54758648328525
Sequences
Protein sequence

MGTGEKTLKSFQLHRKQSVKVKDVPKGCLAIKVGSQGEEQQRFIVPVLYFNHPLFMQLLK
EAEDEYGFDQKGTITIPCHVEEFRYVQALIDGERSVYNGNNHHHRHGGRDQYHHLVGCFR
A

MGSGEKILKSVHSNRPNNVKSNSKHGIKDVPKGCLAIKVGSKEEEKQRFVVPVFYFNHPL
FMQLLREAEEEYGFEQKGTITIPCHVEVFRYVQDMINRERSLDDDDDASKQTGCGAKHGL
THKIRSRSSSGVWKYP

Other information
Ka divergence:0.396583KaKs divergence:0.303039
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):366Length 2 (bp):411Length divergence:0.058
MFE 1 (kcal):-94.1MFE 2 (kcal):-104.5MFE divergence0.052