Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46740-AT2G46750
Species:Arabidopsis
Duplication type:TD
Function (paralog1):D-arabinono-1,4-lactone oxidase family protein
Function (paralog2):D-arabinono-1,4-lactone oxidase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.82887915310769
Log2 mRNA fold difference:0.96958875663108
Log2 TE fold difference:0.23522281430781
Sequences
Protein sequence

MAFGYSPSYCSFWRTLLGLYCLFTLVHTVISTPPEDPVKCVSGNTNCIVTNSLGAFPDRS
TCRAANVAYPTTEAELVSIVAAATKAGRKMRVTTRYSHSIPKLTCTDGNDGLFISTKFLN
HTVQADAKAMTLTVESGVTLRQLIAEAAKVGLALPYAPYWWGVTVGGMMGTGAHGSSLWG
KGSAVHDYVTEIRMVSPGSVNDGFAKIRVLSETTTPNEFNAAKVSLGVLGVISQVTFELQ
PMFKRSLKYVMRNDLDFNDEALTFGKKHEFADFVWLPSQGKVVYRMDDRVAVNTLGNGLY
DFFPFRSQLSAVLATTRSSEETQETLRDAHGKCVTATTISSTLFSTSYGLTNNGITFTGY
PVIGSQNRMMSSGSCLDGLEDKLTSACAWDSRVKGVFYHQTTFSIPLTQVKSFINDIKSL
LKIDSKSLCGLELYYGILMRYVTSSPAYLGKETEAIDFDITYYRANDPLTPRLYEDFIEE
IEQIALLKYNALPHWGKNRNLAFDGVIKKYKNAPAFLKVKESYDPNGLFSSEWTDQILGI
KGNPTIVKDGCALEGLCICSDDAHCAPSKGYLCRPGKVYKEARVCTHVPK

MAFTFPPSYRTLVGLYYIFTLMHTAVSTPPDDPVKCVSGNTNCTVTNSYGAFPDRSTCRA
ANVAYPKTEAELVSVVAAATQAGRKMRVTTRYSHSITKLVCTDGTEGLFISTKFLNHTVQ
ADATAMTMTVESGMTLRQLIVEAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSA
VHDYVTEIRMVSPGSVNEGFAKIRILSETTTPNEFNAAKVSLGVLGVISQVTFELQPMFK
RSLTYTMRNDSDFEDQAVTFGKKHEFADFIWLPSQGKVVYRRDDRVAVNTSGNGLFDFLP
FRSQLSAAIAIIRTSEETQERFRDANGKCVGATIISSTLFAPSYGLTNNGIIFTGYPVVG
SQNRMMSSGSCLDSLQDGLITACAWDSRIKGEFFHQTTLSVPLTQVKSFISDIKSLVKIE
QKSLCGLELHYGILMRYVTSSPAYLGKETEALDFDITYYRAKDPLTPRLYEDFIEEIEQI
ALFKYNALPHWGKNRNLAFDGVIRKYNNAPAFLKVKDSYDPKGLFSSEWTDQILGIKGNA
SIVKDGCALEGLCICSKDAHCAPAKGYLCRPGKVYKEARVCTRVDGIISVI

Other information
Ka divergence:-0.110061KaKs divergence:-0.999825
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1773Length 2 (bp):1776Length divergence:0.001
MFE 1 (kcal):-529.73MFE 2 (kcal):-543.57MFE divergence0.013