Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46810-AT3G61950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic helix-loop-helix (bHLH) DNA-binding superfamily protein
Function (paralog2):basic helix-loop-helix (bHLH) DNA-binding superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.38894057622967
Log2 mRNA fold difference:-0.16479651999072
Log2 TE fold difference:0.51578361150804
Sequences
Protein sequence

MFVLRVSNQSFKLHQQVQCKDEIFCLDQKVNVRRSLQVQETVEDHQSFALEEEEQQLSTP
SLLQDTTIPFLQMLQQSEDPSPFLSFKDPSFLALLSLQTLEKPWELENYLPHEVPEFHSP
IHSETNHYYHNPSLEGVNEAISNQELPFNPLENARSRRKRKNNNLASLMTREKRKRRRTK
PTKNIEEIESQRMTHIAVERNRRRQMNVHLNSLRSIIPSSYIQRGDQASIVGGAIDFVKI
LEQQLQSLEAQKRSQQSDDNKEQIPEDNSLRNISSNKLRASNKEEQSSKLKIEATVIESH
VNLKIQCTRKQGQLLRSIILLEKLRFTVLHLNITSPTNTSVSYSFNLKMEDECNLGSADE
ITAAIRQIFDS

MERFQGHINPCFFDRKPDVRSLEVQGFAEAQSFAFKEKEEESLQDTVPFLQMLQSEDPSS
FFSIKEPNFLTLLSLQTLKEPWELERYLSLEDSQFHSPVQSETNRFMEGANQAVSSQEIP
FSQANMTLPSSTSSPLSAHSRRKRKINHLLPQEMTREKRKRRKTKPSKNNEEIENQRINH
IAVERNRRRQMNEHINSLRALLPPSYIQRGDQASIVGGAINYVKVLEQIIQSLESQKRTQ
QQSNSEVVENALNHLSGISSNDLWTTLEDQTCIPKIEATVIQNHVSLKVQCEKKQGQLLK
GIISLEKLKLTVLHLNITTSSHSSVSYSFNLKMEDECDLESADEITAAVHRIFDIPTI

www.000webhost.com

Other information
Ka divergence:-0.137779KaKs divergence:0.0238709
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1116Length 2 (bp):1077Length divergence:-0.018
MFE 1 (kcal):-258MFE 2 (kcal):-252MFE divergence-0.012