Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46870-AT3G61970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):AP2/B3-like transcriptional factor family protein
Function (paralog2):AP2/B3-like transcriptional factor family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.16536680449687
Log2 mRNA fold difference:-1.7169759832603
Log2 TE fold difference:1.7581576192468
Sequences
Protein sequence

MMTDLSLTRDEDEEEAKPLAEEEGAREVADREHMFDKVVTPSDVGKLNRLVIPKQHAERF
FPLDSSSNEKGLLLNFEDLTGKSWRFRYSYWNSSQSYVMTKGWSRFVKDKKLDAGDIVSF
QRCVGDSGRDSRLFIDWRRRPKVPDHPHFAAGAMFPRFYSFPSTNYSLYNHQQQRHHHSG
GGYNYHQIPREFGYGYFVRSVDQRNNPAAAVADPLVIESVPVMMHGRANQELVGTAGKRL
RLFGVDMECGESGMTNSTEEESSSSGGSLPRGGGGGASSSSFFQLRLGSSSEDDHFTKKG
KSSLSFDLDQ

MNQEDKEKPIEEASSSMEREHMFDKVVTPSDVGKLNRLVIPKQHAERYFPLDNSTTNDSN
KGLLLNFEDRSGNSWRFRYSYWNSSQSYVMTKGWSRFVKDKKLDAGDIVSFQRDSCNKDK
LYIDWRRRPKIPDHHHQQFAGAMFPRFYTFPHPQMPTNYETHNLYHRFHQRDLGIGYYVR
SMERSHPTAVIESVPVMMQRRAQVASMASRGEKRLRLFGVDMECGGGGGSVNSTEEESSS
SGGSIPRGRVSMVGAGSLLQLRLVSSDDESLVAMEAASLEDHHFFTKKGKPSLSFDLDR

Other information
Ka divergence:0.00243522KaKs divergence:0.128974
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):933Length 2 (bp):900Length divergence:-0.018
MFE 1 (kcal):-285.6MFE 2 (kcal):-282.41MFE divergence-0.006