Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46930-AT3G62060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pectinacetylesterase family protein
Function (paralog2):Pectinacetylesterase family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.8287465093414
Log2 mRNA fold difference:-2.1178791115074
Log2 TE fold difference:0.34426442486546
Sequences
Protein sequence

MKSVLRIAAAIFWLWLFIVLGVIGSGNVRDTDDEISLLESQLVVTSPSQLLMVPLTLIQA
AASKGAVCLDGTLPGYHLHPGSGSGANRWLIQLEGGGWCNTRRSCIFRKTTRRGSSNHME
KVLAFTGILSNKSNENPDFFNWNRVKLRYCDGASFTGDSQDESSQLYYRGQRIWHSAMEE
LLSKGMQKAEQALLSGCSAGGLASILHCDQFKELFPGTTTVKCLSDAGMFMDAVDVSGGH
SLRKMFQGVVTVQNLQKELSTACTKHLDPTSCFFPQNLVSGIKTPMFLLNAAYDAWQVQE
SLAPPSVDLSGSWKACKSDHSHCNSSQIQFFQDFRTHMVDAVKSFATSTHNGVFINSCFA
HCQSERQDTWYAPDSPTLHGKTVAESVGDWYFDRTTVKAIDCPYPCDKTCHNLIFK

MRSLLLWIAVVVCLLCSVAAVVQSGSSDGFGKPRDTETAISFLEYKLMAPSVPMIPLTLI
HGADSKGAVCLDGTLPGYHLDRGFGSGANSWLIQLEGGGWCNNHRSCVYRKTSRRGSSKF
MEKALAFTGILSNRSEENPDFFNWNRIKLRYCDGASFSGDSQDESSQLFYRGQRIWQVAM
EEFLSLGMKQANQALLSGCSAGGLASILHCDEFRELLPSSTKVKCLSDAGMFLDSVDVSG
GHSLRNMFQGVVTVQNLQKDLSSTCTNHLDPTSCFFPQNLVSDIKTPMFLLNTAYDSWQI
QESLAPPTADPGGIWKACKSDHSRCNSSQIQFFQEFRNQMLFAVNSFSNSDQNGLYINSC
FAHCQTERQDTWFAQDSPQLNGKRVAESVGDWYFDRAKNVKAIDCPYPCDTTCHNLIFE

www.000webhost.com

Other information
Ka divergence:-0.106256KaKs divergence:-0.0336596
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1251Length 2 (bp):1260Length divergence:0.004
MFE 1 (kcal):-398.87MFE 2 (kcal):-390.34MFE divergence-0.011