Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G46970-AT3G62090
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):phytochrome interacting factor 3-like 1
Function (paralog2):phytochrome interacting factor 3-like 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.0986933114976
Log2 mRNA fold difference:-3.5945710130335
Log2 TE fold difference:2.1083006473191
Sequences
Protein sequence

MEAKPLASSSSEPNMISPSSNIKPKLKDEDYMELVCENGQILAKIRRPKNNGSFQKQRRQ
SLLDLYETEYSEGFKKNIKILGDTQVVPVSQSKPQQDKETNEQMNNNKKKLKSSKIEFER
NVSKSNKCVESSTLIDVSAKGPKNVEVTTAPPDEQSAAVGRSTELYFASSSKFSRGTSRD
LSCCSLKRKYGDIEEEESTYLSNNSDDESDDAKTQVHARTRKPVTKRKRSTEVHKLYERK
RRDEFNKKMRALQDLLPNCYKDDKASLLDEAIKYMRTLQLQVQMMSMGNGLIRPPTMLPM
GHYSPMGLGMHMGAAATPTSIPQFLPMNVQATGFPGMNNAPPQMLSFLNHPSGLIPNTPI
FSPLENCSQPFVVPSCVSQTQATSFTQFPKSASASNLEDAMQYRGSNGFSYYRSPN

MMFLPTDYCCRLSDQEYMELVFENGQILAKGQRSNVSLHNQRTKSIMDLYEAEYNEDFMK
SIIHGGGGAITNLGDTQVVPQSHVAAAHETNMLESNKHVDDSETLKASSSKRMMVDYHNR
KKIKFIPPDEQSVVADRSFKLGFDTSSVGFTEDSEGSMYLSSSLDDESDDARPQVPARTR
KALVKRKRNAEAYNSPERNQRNDINKKMRTLQNLLPNSHKDDNESMLDEAINYMTNLQLQ
VQMMTMGNRFVTPSMMMPLGPNYSQMGLAMGVGMQMGEQQFLPAHVLGAGLPGINDSADM
LRFLNHPGLMPMQNSAPFIPTENCSPQSVPPSCAAFPNQIPNPNSLSNLDGATLHKKSRK
TNR

www.000webhost.com

Other information
Ka divergence:0.188691KaKs divergence:0.499041
GC content 1 (%):39GC content 2 (%):42GC content divergence:0.037
Length 1 (bp):1251Length 2 (bp):1092Length divergence:-0.068
MFE 1 (kcal):-306.65MFE 2 (kcal):-294.24MFE divergence-0.021