Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47000-AT3G62150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ATP binding cassette subfamily B4
Function (paralog2):P-glycoprotein 21

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.68611620961949
Log2 mRNA fold difference:1.1690602855717
Log2 TE fold difference:-0.29863786144797
Sequences
Protein sequence

MASESGLNGDPNILEEVSETKRDKEEEEEVKKTEKKDEEHEKTKTVPFYKLFAFADSFDF
LLMILGTLGSIGNGLGFPLMTLLFGDLIDAFGENQTNTTDKVSKVALKFVWLGIGTFAAA
FLQLSGWMISGERQAARIRSLYLKTILRQDIAFFDIDTNTGEVVGRMSGDTVLIQDAMGE
KVGKAIQLLATFVGGFVIAFVRGWLLTLVMLSSIPLLVMAGALLAIVIAKTASRGQTAYA
KAATVVEQTIGSIRTVASFTGEKQAISNYNKHLVTAYKAGVIEGGSTGLGLGTLFLVVFC
SYALAVWYGGKLILDKGYTGGQVLNIIIAVLTGSMSLGQTSPCLSAFAAGQAAAYKMFET
IERRPNIDSYSTNGKVLDDIKGDIELKDVYFTYPARPDEQIFRGFSLFISSGTTVALVGQ
SGSGKSTVVSLIERFYDPQAGDVLIDGINLKEFQLKWIRSKIGLVSQEPVLFTASIKDNI
AYGKEDATTEEIKAAAELANASKFVDKLPQGLDTMVGEHGTQLSGGQKQRIAVARAILKD
PRILLLDEATSALDAESERVVQEALDRIMVNRTTVVVAHRLSTVRNADMIAVIHQGKIVE
KGSHTELLKDPEGAYSQLIRLQEEKKSDENAAEEQKMSSIESFKQSSLRKSSLGRSLSKG
GSSRGNSSRHSFNMFGFPAGIDGNVVQDQEEDDTTQPKTEPKKVSIFRIAALNKPEIPVL
ILGSISAAANGVILPIFGILISSVIKAFFQPPKKLKEDTSFWAIIFMVLGFASIIAYPAQ
TFFFAIAGCKLVQRIRSMCFEKVVHMEVGWFDEPENSSGTIGARLSADAATIRGLVGDSL
AQTVQNLSSILAGLIIAFLACWQLAFVVLAMLPLIALNGFLYMKFMKGFSADAKKMYGEA
SQVANDAVGSIRTVASFCAEDKVMNMYSKKCEGPMKNGIRQGIVSGIGFGFSFFVLFSSY
AASFYVGARLVDDGKTTFDSVFRVFFALTMAAMAISQSSSLSPDSSKADVAAASIFAIMD
RESKIDPSVESGRVLDNVKGDIELRHVSFKYPARPDVQIFQDLCLSIRAGKTVALVGESG
SGKSTVIALLQRFYDPDSGEITLDGVEIKSLRLKWLRQQTGLVSQEPILFNETIRANIAY
GKGGDASESEIVSSAELSNAHGFISGLQQGYDTMVGERGIQLSGGQKQRVAIARAIVKDP
KVLLLDEATSALDAESERVVQDALDRVMVNRTTIVVAHRLSTIKNADVIAVVKNGVIVEK
GKHDTLINIKDGVYASLVQLHLTAAS

MDSVIESEEGLKVDSPNRADAETSNSKIHEEDEKELKTESDLKEEKKKTEKNKQEEDEKT
KTVPFHKLFAFADSFDIILMILGTIGAVGNGLGFPIMTILFGDVIDVFGQNQNSSDVSDK
IAKVALKFVYLGLGTLVAALLQVSGWMISGERQAGRIRSLYLQTILRQDIAFFDVETNTG
EVVGRMSGDTVLIQDAMGEKVGKAIQLVSTFIGGFVIAFTEGWLLTLVMVSSIPLLVMSG
AALAIVISKMASRGQTSYAKAAVVVEQTVGSIRTVASFTGEKQAISNYNKHLVSAYRAGV
FEGASTGLGLGTLNIVIFCTYALAVWYGGKMILEKGYTGGQVLIIIFAVLTGSMSLGQAS
PCLSAFAAGQAAAYKMFEAIKRKPEIDASDTTGKVLDDIRGDIELNNVNFSYPARPEEQI
FRGFSLSISSGSTVALVGQSGSGKSTVVSLIERFYDPQSGEVRIDGINLKEFQLKWIRSK
IGLVSQEPVLFTSSIKENIAYGKENATVEEIRKATELANASKFIDKLPQGLDTMVGEHGT
QLSGGQKQRIAVARAILKDPRILLLDEATSALDAESERIVQEALDRIMVNRTTVVVAHRL
STVRNADMIAVIHQGKIVEKGSHSELLRDPEGAYSQLIRLQEDTKQTEDSTDEQKLSMES
MKRSSLRKSSLSRSLSKRSSSFSMFGFPAGIDTNNEAIPEKDIKVSTPIKEKKVSFFRVA
ALNKPEIPMLILGSIAAVLNGVILPIFGILISSVIKAFFKPPEQLKSDTRFWAIIFMLLG
VASMVVFPAQTIFFSIAGCKLVQRIRSMCFEKVVRMEVGWFDETENSSGAIGARLSADAA
TVRGLVGDALAQTVQNLASVTAGLVIAFVASWQLAFIVLAMLPLIGLNGYIYMKFMVGFS
ADAKRMYEEASQVANDAVGSIRTVASFCAEEKVMKMYKKKCEGPMRTGIRQGIVSGIGFG
VSFFVLFSSYAASFYAGARLVDDGKTTFDSVFRVFFALTMAAVAISQSSSLSPDSSKASN
AAASIFAVIDRESKIDPSDESGRVLDNVKGDIELRHISFKYPSRPDVQIFQDLCLSIRAG
KTIALVGESGSGKSTVIALLQRFYDPDSGQITLDGVEIKTLQLKWLRQQTGLVSQEPVLF
NETIRANIAYGKGGDATETEIVSAAELSNAHGFISGLQQGYDTMVGERGVQLSGGQKQRV
AIARAIVKDPKVLLLDEATSALDAESERVVQDALDRVMVNRTTVVVAHRLSTIKNADVIA
VVKNGVIVEKGKHETLINIKDGVYASLVQLHLSAST

Other information
Ka divergence:0.0479891KaKs divergence:-0.396057
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):3861Length 2 (bp):3891Length divergence:0.004
MFE 1 (kcal):-1186.16MFE 2 (kcal):-1217.9MFE divergence0.013