Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47060-AT3G62220
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.2420254458362
Log2 mRNA fold difference:-1.1194586119998
Log2 TE fold difference:-0.056407904869361
Sequences
Protein sequence

MSCFGCCGEDDDMHKTADYGGRHNQAKHFPPGNDARHHQASETAQKGPPVVKLQPIEVPI
IPFSELKEATDDFGSNSLIGEGSYGRVYYGVLNNDLPSAIKKLDSNKQPDNEFLAQVSMV
SRLKHDNFVQLLGYCVDGNSRILSYEFANNGSLHDILHGRKGVKGAQPGPVLSWYQRVKI
AVGAARGLEYLHEKANPHIIHRDIKSSNVLLFEDDVAKIADFDLSNQAPDMAARLHSTRV
LGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHRLPRGQQSLVTWATPKLS
EDKVKQCVDARLGGDYPPKAVAKVRNQTFHNLRLCLRFRLHSLFLTSSYGDDDSQLAAVA
ALCVQYEADFRPNMSIVVKALQPLLNARAVAPGEGVH

MSCFGCCREDDLPGANDYGGHNMTKQSGGNDGRRNGSETAQKGAQSVKVQPIEVAAILAD
ELIEATNDFGTNSLIGEGSYARVYHGVLKNGQRAAIKKLDSNKQPNEEFLAQVSMVSRLK
HVNFVELLGYSVDGNSRILVFEFAQNGSLHDILHGRKGVKGAKPGPLLSWHQRVKIAVGA
ARGLEYLHEKANPHVIHRDIKSSNVLIFDNDVAKIADFDLSNQAPDMAARLHSTRVLGTF
GYHAPEYAMTGQLSAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKV
KQCVDSRLGGDYPPKAVAKLAAVAALCVQYEADFRPNMSIVVKALQPLLNARTGPAGEGA
P

www.000webhost.com

Other information
Ka divergence:0.0645769KaKs divergence:0.0643604
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1194Length 2 (bp):1086Length divergence:-0.047
MFE 1 (kcal):-349.64MFE 2 (kcal):-343.7MFE divergence-0.009