Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47090-AT3G62240
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):zinc ion binding;nucleic acid binding
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.8202599556911
Log2 mRNA fold difference:1.7782468303452
Log2 TE fold difference:0.012379870964995
Sequences
Protein sequence

MDDSCAVCAENLEWVGYGSCGHREVCSTCVVRLRFILNDRRCCICKTECPVVFVTKALGD
YTKTISDFSTTFPSVPKEGRVGSFWYHEETNVYFDDLNHYTRIKAMCRLSCNLCNDTNKT
RPKKEPNHCVRFKSVEHLKDHLNHQHKLHMCSLCLVGRKVFICEQKLFTKGQLNQHISSG
DSEVDGSESERGGFTGHPMCEFCKRPFYGDNELYTHMSREHYTCHICQRLKPGQYEYYGN
YDDLEVHFRSDHFLCEDETCLAKKFIVFQIEAELKRHNAIDHGGRMSRSQQNASLQIQAS
FQYPNSRRGRRRSSLREPNLVLLESQASYAFNDDNNLPQHVGRSGNSRLGESSFPPLSVQ
ANQGQSRFGQNSESLVSNTTTTRQRHRANQGQSRFGQNSESLVSNTTTTRQRHQTNRSAT
SGSSQAWPALNRGPAEISITSRVQSSGASAQSQSRHHDRVESTRTLASAVPQDARTTVGG
CSSGSSLSSANATKRNNHHSSSTPKMSETRSLAQPSHSDSPQISAVKNRRSSSTSANAGN
IQVAQGVSDVQSDNKSLVEKIHASLGHDEELFMAFKNTSGKYRHGSIDARTYLEYVKGYG
LSHLVLDMARLCPDPQRQKELIDTHNACLKGGNKGKAVKVESSSDSKGDRFVDTVRKLQF
SDKSQDKDKDKDAYRSDKGKTKVTTLVNSSSAGVGLGDTGKQPKKTSKFLRTRLGEKSMA
AVLDLRNSNPEPEPEPKNDNSKRSQNSPGGLPLRGAWKRGSAKLFV

MDDSCAVCADNLEWVAYGSCGHREVCSTCVVRLRFVLDDPRCCICKTESPIVFVTKALGD
YTRTINDFSTFPSAPREGRVGAFWYHEDTQAFFDDLDQYRMIKAMCRLSCGVCDKTEDKP
REGGPRHHRQRIKSVEQLKGHLYHKHKLHMCGLCLEGRKIFICEQKLYTRAQLNQHIQTG
DSEVDGSESERGGFAGHPMCEFCRNPFYGDNELYTHMSTEHYTCHLCQRSQPGQYEYYKN
YDDLEIHFRRDHFLCEDDSCLAKKFTVFQNESELKRHNAIEHGGKMSRSQRSAALQIPTS
FRYSRGNDQENRRGRPRSFRREPGDEEYNLAVHAALRLSESEYSRQEPAPPPSSAPPGFS
ENNNIHVDDTDPLIQPMESLSTTDMEPSSRYLQAVGSFGGGGSRLGESAFPPLSGQQSSG
QNVESLPTNTMAARLRRQTNRTSTASAIASPSQGWPVINRGPGQASITSGGNHSSSGWPA
IGRTPVQASSSSVQSRSHNRVSQPRPLASAVPQAARNANRIPHSSSAPNLSDTRSLQPSH
SDFPPVSSAVVQNRKTSSTTTQGSSNTQPPPDVQSANKSLIEKMRSALGHDEDVFVAFRN
ISGQYRQGSIDAKTYLEYVQGYGLSHLVIDLARLCPDPKRQKELIDTHNASLREEDSKDN
GRSAAQSSSQPKESQSSKKNKGKAVKVVDPKETLADNFMDTVRRLQSSQNPQEEEEEAIS
KDKNTYRSDKGKSQVVGTDSSSTGSKQQRKKTSKFHRVRLGDGSMAALLDLNNSTRESEQ
ESKDSNSNSNQNQTGGLPVRGVWRKGGANLFS

Other information
Ka divergence:-0.17644KaKs divergence:-0.375432
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):2301Length 2 (bp):2439Length divergence:0.029
MFE 1 (kcal):-658.2MFE 2 (kcal):-715.91MFE divergence0.042