Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47110-AT3G62250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ubiquitin 6
Function (paralog2):ubiquitin 5

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.25753829104256
Log2 mRNA fold difference:0.29139536005416
Log2 TE fold difference:0.012125403824956
Sequences
Protein sequence

MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKE
CPNATCGAGTFMASHFDRHYCGKCGLTYVYQKEGAQE

MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKIDGSGKVQRLRKE
CPNATCGAGTFMASHFDRHYCGKCGLTYVYQKEGVEA

www.000webhost.com

Other information
Ka divergence:0.317977KaKs divergence:-0.985054
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):474Length 2 (bp):474Length divergence:0
MFE 1 (kcal):-135MFE 2 (kcal):-143.9MFE divergence0.032