Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47160-AT3G62270
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):HCO3- transporter family
Function (paralog2):HCO3- transporter family

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.15541295653656
Log2 mRNA fold difference:-0.18503070923369
Log2 TE fold difference:0.036907883170912
Sequences
Protein sequence

MEETFVPFEGIKNDLKGRLMCYKQDWTGGFKAGFRILAPTTYIFFASAIPVISFGEQLER
STGNSAKSFYLALFQLRNLKLDSEIFADGVLTAVQTLASTAICGMIHSIIGGQPLLILGV
AEPTVIMYTFMFNFAKARPELGRDLFLAWSGWVCVWTALMLFVLAICGACSIINRFTRVA
GELFGLLIAMLFMQQAIKGLVDEFRIPERENQKLKEFLPSWRFANGMFALVLSFGLLLTG
LRSRKARSWRYGTGWLRSLIADYGVPLMVLVWTGVSYIPAGDVPKGIPRRLFSPNPWSPG
AYGNWTVVKEMLDVPIVYIIGAFIPASMIAVLYYFDHSVASQLAQQKEFNLRKPSSYHYD
LLLLGFLTLMCGLLGVPPSNGVIPQSPMHTKSLATLKYQLLRNRLVATARRSIKTNASLG
QLYDNMQEAYHHMQTPLVYQQPQGLKELKESTIQATTFTGNLNAPVDETLFDIEKEIDDL
LPVEVKEQRVSNLLQSTMVGGCVAAMPILKMIPTSVLWGYFAFMAIESLPGNQFWERILL
LFTAPSRRFKVLEDYHATFVETVPFKTIAMFTLFQTTYLLICFGLTWIPIAGVMFPLMIM
FLIPVRQYLLPRFFKGAHLQDLDAAEYEEAPALPFNLAAETEIGSTTSYPGDLEILDEVM
TRSRGEFRHTSSPKVTSSSSTPVNNRSLSQVFSPRVSGIRLGQMSPRVVGNSPKPASCGR
SPLNQSSSN

MEETFVPFEGIKNDLKGRLMCYKQDWTGGIKAGFRILAPTTYIFFASAIPVISFGEQLER
STDGVLTAVQTLASTAICGIIHSIIGGQPLLILGVAEPTVIMYTFMFNFAKGRPELGRNL
FLAWSGWVCVWTSLILFVLAICGACSFINRFTRVAGELFGLLIAMLFMQQAIKGLVDEFR
APAREDLKLVEFLPSWRFANGMFALVLSFGLLITALRSRKARSWRYGTGWLRSLVADYGV
PLMVLVWTGVSYIPTGDVPKGIPRRLFSPNPWSPGAYENWTVVKEMLQVPIVYIIGAFIP
ATMIAVLYYFDHSVASQLAQQKEFNLRKPSSYHYDLLLLGFLTLMCGLLGIPPSNGVIPQ
SPMHTKSLATLKYQLLRNRLVATARKSIKQNASLGQLYGNMQDVYNQMQTPLVYQQPQGL
KELRESTIQATTFTGNLDAPVDETLFDIEKEIDDLLPIEVKEQRVSNLLQAVMVGGCVAA
MPLLKMIPTSVLWGYFAFMAIESLPGNQFWERILLLFTAPSRRFKVLEDNHATFVETVPF
KTIAMFTIFQTTYLLTCFGLTWIPIAGVMFPLLIMFLIPVRQYILPRFFKSAHLQDLDAA
EYEEAPALPFHLAVPEAEMGSTASYPCDSEILDEFITRSRGEFRHTCSPKVTSSTSTPVY
NRNLSQVFSPRVIDLRGEMSPRLSGKGQNSPKPSPLNPSSSSK

www.000webhost.com

Other information
Ka divergence:0.0679672KaKs divergence:0.199715
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):2190Length 2 (bp):2112Length divergence:-0.018
MFE 1 (kcal):-663.71MFE 2 (kcal):-628.93MFE divergence-0.027