Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47230-AT3G62300
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DOMAIN OF UNKNOWN FUNCTION 724 6
Function (paralog2):DOMAIN OF UNKNOWN FUNCTION 724 7

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:3.285073180839
Log2 mRNA fold difference:2.2089034666087
Log2 TE fold difference:0.9822823106693
Sequences
Protein sequence

MEETIRKGSEVEVSSTEEGFADAWFRGILQENPTKSGRKKLRVRYLTLLNDDALSPLIEN
IEPRFIRPVPPENEYNGIVLEEGTVVDADHKDGWWTGVIIKKLENGKFWVYYDSPPDIIE
FERNQLRPHLRWSGWKWLRPDIQELDKSMFSSGTMAEVSTIVDKAEVAWFPAMIIKEIEV
DGEKKFIVKDCNKHLSFSGDEARTNSTIDSSRVRPTPPPFPVEKYELMDRVEVFRGSVWR
QGLVRGVLDHNCYMVCLVVTKEEPVVKHSDLRPCKVWEDGQTPVIETPSNVMKTKPMRSC
SGAKSMTPKRTTKHARRSLNLEKSAETLTKAESRAATGELRSKRANDVINDNTPLVITPQ
VKPIASVEPVTPSRVRTATPLKQTKADTQGKSSPKKTLEPMRDENGLENSTRQKVLEEKN
SEKKGRKRKRQEEHNSDLKETDESCNGQMAEINDTSSICNDVDDQPLAAWINLPTDNFFF
FFFFIVLIYPETSIDHSPIVVNNAAIATDVEERQANDTLMILPFAKKSPFWKMYETQEVC
KIAPQSPHFSPLFEAKEELREWTAVGMMVSFYGLLEEVKNLQLDVSPSTLGSLSCSFAEL
EKHGFDVAAPQSRINKMLSLQDERAKKAEERKGLEKKIEAGEIEGHTYEEEMAELELKIL
ELKRQQVVAKEMKEATDKVTSGMKSYAEMINQEIEDLRLEFQSTASAPW

MLLTTGRKEKLSVSKGSEIEISSQEYEYGSGNVWYCVILEENLAKSKRKKLSVRHLDPLL
KYDYSPPLIKTTVHRFMRPVPPPDPFPEVDFEEGDVVDAAYKGGWCSGSVVKVLGNRRFL
VYLRFQPDVIELLRKDLRPHFVWKDEEWFRCEKQQLIESDFSAGKSVEVRTKVDKLGDVW
APAMVIKEDEDGTMLVKLKTLKEEEVNCTKISVSYSEIRPSPLPIGLRDYKLMENVDALV
ESGWCPGVVSKVLAGKRYAVDLGPNRESKEFSRLQLRPSIEWKDGIWHRKEKVSGSEESS
HAVEETAASTRIRITVRTALKEKKALGTGINVRTTRSSSGAMHNPLPASFNGGDVAEAGR
VSVTVNETPLFETAAQLSGELGNSLADVVMNESAPVTSQPEIAAPKEFHPSVVLGVAAAV
KTQGKTTPKKKLQAMKNQKSSTNDSVGEKVSVNKRKRGQPRKFIVAEPKQKIGVSGNNSK
AATIEHADMTDDDRPLASWVHTGNSSSGQSVSRTPDIGLNTVVEKHVDIVETPPGRESTM
VLPFVKKSQLWKVLESMEVFKVVPQSPHFSPLLESEEECREGDAIGRMVMFSSLLEKVNN
LQVDDPISSINRIDECFLKLEKHGFNVTTPRSRIAKILSIKERQTCALEELKAVEEKITE
NDNKRRKYEEDIVELQRQEVLMKEAKVTLDNEIARMQSQAAVLDQEVQNVDHEFQAILAA
PWK

www.000webhost.com

Other information
Ka divergence:-0.118092KaKs divergence:-0.613203
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):2130Length 2 (bp):2172Length divergence:0.01
MFE 1 (kcal):-594.76MFE 2 (kcal):-635.94MFE divergence0.033