Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47250-AT3G62310
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA helicase family protein
Function (paralog2):RNA helicase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.021430070753231
Log2 mRNA fold difference:-0.12289145989656
Log2 TE fold difference:0.13917700262713
Sequences
Protein sequence

MGTERKRKVSLFDVMEDPSLSSKNTKSNGLGLAAAAGGGSNLINKWNGKAYSQRYFEILE
KRRDLPVWLQKDDFLNTLNSNQTLILVGETGSGKTTQIPQFVLDAVVADNSDKGRKWLVG
CTQPRRVAAMSVSRRVADEMDVSIGEEVGYSIRFEDCTSSRTMLKYLTDGMLLREAMADP
LLERYKVIILDEAHERTLATDVLFGLLKEVLRNRPDLKLVVMSATLEAEKFQEYFSGAPL
MKVPGRLHPVEIFYTQEPERDYLEAAIRTVVQIHMCEPPGDILVFLTGEEEIEDACRKIN
KEVSNLGDQVGPVKVVPLYSTLPPAMQQKIFDPAPVPLTEGGPAGRKIVVSTNIAETSLT
IDGIVYVIDPGFAKQKVYNPRIRVESLLVSPISKASAHQRSGRAGRTRPGKCFRLYTEKS
FNNDLQPQTYPEILRSNLANTVLTLKKLGIDDLVHFDFMDPPAPETLMRALEVLNYLGAL
DDEGNLTKTGEIMSEFPLDPQMSKMLIVSPEFNCSNEILSVSAMLSVPNCFVRPREAQKA
ADEAKARFGHIDGDHLTLLNVYHAYKQNNEDPNWCFENFVNNRAMKSADNVRQQLVRIMS
RFNLKMCSTDFNSRDYYVNIRKAMLAGYFMQVAHLERTGHYLTVKDNQVVHLHPSNCLDH
KPEWVIYNEYVLTTRNFIRTVTDIRGEWLVDVAQHYYDLSNFPNCEAKRALEKLYKKRER
EKNESKNRK

MGTERKRKISLFDVMDDPSAPAKNAKTSGLPDGGINSLINKWNGKPYSQRYYDILEKRRT
LPVWLQKEEFLKTLNNNQTLILVGETGSGKTTQIPQFVIDAVDAETSDKRRKWLVGCTQP
RRVAAMSVSRRVAEEMDVTIGEEVGYSIRFEDCSSPRTVLKYLTDGMLLREAMADPLLER
YKVIILDEAHERTLATDVLFGLLKEVLKNRPDLKLVVMSATLEAEKFQDYFSGAPLMKVP
GRLHPVEIFYTQEPERDYLEAAIRTVVQIHMCEPPGDILVFLTGEEEIEDACRKINKEVG
NLGDQVGPIKVVPLYSTLPPAMQQKIFDPAPEPVTEGGPPGRKIVVSTNIAETSLTIDGI
VYVIDPGFAKQKVYNPRIRVESLLVSPISKASAHQRSGRAGRTRPGKCFRLYTEKSFNND
LQPQTYPEILRSNLANTVLTLKKLGIDDLVHFDFMDPPAPETLMRALEVLNYLGALDDDG
NLTKTGEIMSEFPLDPQMAKMLIVSPEFNCSNEILSVSAMLSVPNCFIRPREAQKAADEA
KARFGHIEGDHLTLLNVYHAFKQNNEDPNWCYENFINNRAMKSADNVRQQLVRIMSRFNL
KMCSTDFNSRDYYINIRKAMLAGYFMQVAHLERTGHYLTVKDNQVVHLHPSNCLDHKPEW
VIYNEYVLTSRNFIRTVTDIRGEWLVDVASHYYDLSNFPNCEAKRVIEKLYKKREREKEE
SKKNRK

www.000webhost.com

Other information
Ka divergence:-0.265263KaKs divergence:-0.172
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):2190Length 2 (bp):2181Length divergence:-0.002
MFE 1 (kcal):-658.4MFE 2 (kcal):-668.41MFE divergence0.008