Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47260-AT3G62340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):WRKY DNA-binding protein 23
Function (paralog2):WRKY family transcription factor

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.44417275989447
Log2 mRNA fold difference:-0.80843275085987
Log2 TE fold difference:-0.056601588801942
Sequences
Protein sequence

MEFTDFSKTSFYYPSSQSVWDFGDLAAAERHSLGFMELLSSQQHQDFATVSPHSFLLQTS
QPQTQTQPSAKLSSSIIQAPPSEQLVTSKVESLCSDHLLINPPATPNSSSISSASSEALN
EEKPKTEDNEEEGGEDQQEKSHTKKQLKAKKNNQKRQREARVAFMTKSEVDHLEDGYRWR
KYGQKAVKNSPFPRSYYRCTTASCNVKKRVERSFRDPSTVVTTYEGQHTHISPLTSRPIS
TGGFFGSSGAASSLGNGCFGFPIDGSTLISPQFQQLVQYHHQQQQQELMSCFGGVNEYLN
SHANEYGDDNRVKKSRVLVKDNGLLQDVVPSHMLKEE

MENVGVGMPFYDLGQTRVYPLLSDFHDLSAERYPVGFMDLLGVHRHTPTHTPLMHFPTTP
NSSSSEAVNGDDEEEEDGEEQQHKTKKRFKFTKMSRKQTKKKVPKVSFITRSEVLHLDDG
YKWRKYGQKPVKDSPFPRNYYRCTTTWCDVKKRVERSFSDPSSVITTYEGQHTHPRPLLI
MPKEGSSPSNGSASRAHIGLPTLPPQLLDYNNQQQQAPSSFGTEYINRQEKGINHDDDDD
HVVKKSRTRDLLDGAGLVKDHGLLQDVVPSHIIKEEY

www.000webhost.com

Other information
Ka divergence:0.413429KaKs divergence:0.17038
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1014Length 2 (bp):834Length divergence:-0.097
MFE 1 (kcal):-276.27MFE 2 (kcal):-229.61MFE divergence-0.092