Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47440-AT3G62570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tetratricopeptide repeat (TPR)-like superfamily protein
Function (paralog2):Tetratricopeptide repeat (TPR)-like superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.9253406475744
Log2 mRNA fold difference:-3.7273774902144
Log2 TE fold difference:0.79311483892008
Sequences
Protein sequence

MAVYPNVNGDKKHWWFTHRKLVDKYIKDATTLMASEEANDVASALHLLDAALSISPRLET
ALELKARSLLFLRRFKDVADMLQDYIPSLKLDDEGSASSQGSSSSDGINLLSDASSPGSF
KCFSVSDLKKKVMAGICKKCDKEGQWRYVVLGQACCHLGLMEDAMVLLQTGKRLASAEFR
RRSICWSDDSFLLLSESSSASSPPPESENFTHLLAHIKLLLRRRAAAIAALDAGLFSESI
RHFSKIVDGRRPAPQGFLAECYMHRAAAYRSAGRIAEAIADCNKTLALEPSCIQALETRA
ALLETVRCFPDSLHDLEHLKLLYNTILRDRKLPGPVWKRHNVKYREIPGKLCVLTTKTQK
LKQKIANGETGNVDYYGLIGVRRGCTRSELDRAHLLLCLRYKPDRASSFIERCEFTDQND
VDSVRDRAKMSSLLLYRLIQKGYTAVTAIIAEEQRKNAIAHAQKIEERKPVEKSGSIKRT
GNAETKPVNSNAYQGVFCRDLAAVGNLLTRAGFNHPIPVKYEALTC

MAIYSVHNGDKKHWWFTHKKIVDKYIKDARSLMESEEQNDVASAIHLLDAALSISPRSET
ALELKARSLLFLRRFKDVVDMLQDYIPSLKLAVNEEDGSYSYEGSSYSSSSSQLSRKLLS
DSSPRRDSSFKCFSVSYLKKKIMAGICKNRDQDKQWRYVVLGQACCHLGLMEDALVLLQT
GKRLATVEFRRLSVSLSDDSVSLLLSESSSSSSSSSYAFPPRKVSECETVTNLLAHTKNL
LRRRSAGFAAFDAGLFADSIRHFSKILDGRRRPAPQGFLADCYMHRAAAYKSAGKIAEAI
ADCNKTLALEPSCIHALETRATLLETVRCLPDSLHDLEHLKILYNTILRDRKLPGPPWKR
HNVKYREIPGKLCELTTKSKKLKAKMANGEIGNVDYYGLVGVRRGCTRSELDRANLLLCL
RHKPDKALAFMERCDFFDQSEISSVKDRAKMSSLLLYRLIQRGYTALAAAIAEEEQRKKM
MVLTQMSTKTVEEHEPVEKSGSITLTDFAEIKPGNSNAYQGVFCRDLAAVGSLLSRTGFN
QPIPMKYDAISC

www.000webhost.com

Other information
Ka divergence:0.462536KaKs divergence:-0.416518
GC content 1 (%):50GC content 2 (%):46GC content divergence:-0.042
Length 1 (bp):1581Length 2 (bp):1659Length divergence:0.024
MFE 1 (kcal):-508.39MFE 2 (kcal):-512.6MFE divergence0.004