Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47530-AT2G47540
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Pollen Ole e 1 allergen and extensin family protein
Function (paralog2):Pollen Ole e 1 allergen and extensin family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.0817455807628
Log2 mRNA fold difference:2.4200479941715
Log2 TE fold difference:-0.19396885562882
Sequences
Protein sequence

MASTGAATNLLLLAMVVVVATADYYAQPQPYVPKPTTTYTSPVKTPYLPKSNPDIAIEGF
ILCKSGYKTYPIQGGKVKVVCPVVDSYGKLVAKVTISSYPTDLKGYFYFITYGLSHKVNN
ISSCKVKLESSPVFTCKTPTNVNKGVTGAPLSPDNSKFLSHDNLTLYTLEPFYFSSPVAP
KPVY

MAQTCSILYIPYMLLLSSLFAAGIATITEGELLSSMIGVQGLIYCKRGSKLTPIQGAVAR
VTCERTDEYGYEAEDVTVLSQATDAKGYFLATLSSSEVKDYKKVIKIKECRAFLELSPSD
TCSFPTEINRGISGAILQNYRLLENKLKMKLFTVGPFVFSSEETQDKSIPNGY

www.000webhost.com

Other information
Ka divergence:-0.0719695KaKs divergence:-0.93063
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):555Length 2 (bp):522Length divergence:-0.031
MFE 1 (kcal):-153.82MFE 2 (kcal):-164.2MFE divergence0.033